KEGG   Weeksella virosa: Weevi_0933Help
Entry
Weevi_0933        CDS       T01441                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
wvi  Weeksella virosa
Pathway
wvi00260  Glycine, serine and threonine metabolism
wvi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
wvi01100  Metabolic pathways
wvi01110  Biosynthesis of secondary metabolites
wvi01130  Biosynthesis of antibiotics
wvi01230  Biosynthesis of amino acids
Module
wvi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:wvi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Weevi_0933
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Weevi_0933
Enzymes [BR:wvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Weevi_0933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADX67644
UniProt: F0P1L6
Position
981863..983044
Genome map
AA seq 393 aa AA seqDB search
MKFTIDKNGFYGDFGGAFIPELLQYNCEELQKAFDEYYLTEEFQQEFRSLLKDYVGRPSP
LYYAPNLSRRYGAHILLKREDLNHTGAHKINNTIGQALLAKRMGKKKLLAETGAGQHGVA
TATICALLGLECTVFMGEVDIARQAPNVARMKMLGAEVLAATSGSKTLKDATNEAIRYWI
NNPETYYLIGSVVGPHPYPAMVAEFQSVISEEIRSQLQEKYQQEMPDYVIACVGGGSNAA
GAFYHFLDDDQVQLIAVEAAGKGIDTDETAATIQRGSEGIIHGSRTLLMQDDDGQIIEPY
SISAGLDYPGIGPLHAHLHKTGRARFENATDEEALAAAFLLTQTEGIIPALESAHALAAL
EKMTFKKDDLVVVNLSGRGDKDMATYQQYHQKE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttaccatagacaaaaacggattttacggagattttggaggagcatttatccca
gaactcctacaatacaattgcgaagaattgcaaaaagctttcgatgagtattatcttacc
gaagaatttcagcaagagtttcgctcgttgctcaaggattatgttggtcgcccgagccca
ttgtactatgcaccgaacctttctcgacgatacggcgctcatattctcctcaaacgagaa
gacctcaaccatacgggtgcccacaaaataaacaatacgattgggcaagcattgttagcc
aaacgcatgggcaagaaaaagctattggccgaaacaggtgccggacaacatggtgtggca
acggcaacgatttgtgcgttgttgggattagaatgtacggtttttatgggtgaagtagac
atcgcacgacaagcgcccaatgtagctcgcatgaaaatgctgggagcagaagtactggct
gccacttcgggcagtaaaacgctaaaagatgccaccaatgaagctattcggtattggatc
aataatccagaaacgtattacctcatcgggtcggtggttggtccgcatccttacccggcg
atggttgcagaatttcagtcggtgatttcagaggaaattcgaagccaattacaagaaaaa
tatcaacaagaaatgcccgattacgtcattgcttgtgtaggtggcggaagcaatgctgcc
ggagctttctatcattttctggatgatgaccaagtgcaattgatcgctgtagaagcagcc
ggaaaaggaattgatactgatgaaacagccgctaccattcaacgcggatcagaaggtatt
attcacggaagtcgaacacttctaatgcaagatgatgatggacagattattgagccctac
tctatttcggctggattggattatccggggattggaccattgcatgcgcatttgcacaaa
acgggtcgagcgagatttgaaaatgcaaccgatgaagaggctcttgctgctgcttttctt
cttacccaaaccgaaggaattatcccagcgttagaatcggctcatgcgttggcagcctta
gagaaaatgacatttaagaaagatgatcttgtcgtggtgaatctttctgggcgtggtgat
aaagatatggcgacttatcagcaatatcatcaaaaagaatga

DBGET integrated database retrieval system