KEGG   Weeksella virosa: Weevi_1001Help
Entry
Weevi_1001        CDS       T01441                                 

Definition
(GenBank) Alanine racemase
  KO
K01798  Alr-MurF fusion protein [EC:5.1.1.1 6.3.2.10]
Organism
wvi  Weeksella virosa
Pathway
wvi00300  Lysine biosynthesis
wvi00473  D-Alanine metabolism
wvi00550  Peptidoglycan biosynthesis
wvi01100  Metabolic pathways
wvi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:wvi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Weevi_1001
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Weevi_1001
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Weevi_1001
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Weevi_1001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:wvi01011]
    Weevi_1001
Enzymes [BR:wvi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Weevi_1001
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     Weevi_1001
Peptidoglycan biosynthesis and degradation proteins [BR:wvi01011]
 Precursor biosynthesis
  Amino acid ligase
   Weevi_1001
  Racemase
   Weevi_1001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Leuk-A4-hydro_C Bromo_MP
Motif
Other DBs
NCBI-ProteinID: ADX67710
UniProt: F0P200
Position
1051586..1054060
Genome map
AA seq 824 aa AA seqDB search
MKTKTNYNLGELAQILNAKLIGDKEQTIEEYYFDTRTIVCPTNGLFITLKGLQKSGAYYL
DEAYQKGIRSFLVSSIPAQPKDGANYLLVQDVLVALQMLAKHHRQRFTLPLFGITGSNGK
TVVKEWLYQLLWNEYNIARSPKSYNSQLGVPFSVLLIDEHNDLGIFEAGVSQPNEMQALR
CILQPTTAILTNIGSAHLENFLDRRSLALEKIQLLEAAQEIIYPADDELIEELISSNPVF
DSKRRITFGKSDKATVQLKQYQTINGQSSIDIEISGVLFNIIIPFTDQASIQNALICCAS
IYSLNKNLNDYKSKFEKLLPIEMRLEIKEAINNSILINDAFNSDLISLKNALDTLAQQSR
ERKVLVLTDILQSKLADKELYQKTAELVNPYHFTEIVLIGEKISAYKKLFKSYVRAFSST
DDFLRHIQHENIHNEVILLKGSRIFQLEKISDYIEKKSHDTVLEINLEHLEHNIQTYRSL
LKPETKIMAMVKANSYGIGSFEIANVLQQMKVNFLGVAIADEGKELRKAGISTPIIVMNP
EQHSYATVIDYQLEPEIYTARVLQLFLQKLQEKQISQPFPIHIKLETGMNRLGFKPNQLD
ELIEILRSTNLVYVRSIFSHLATADIPTEKDYAQQQFGVFNSSYHYITDKIGYYPIKHIL
NSPGIVAYPQHQYDMVRLGIGMYGYCEYSDFMQKLENVVQFKTVISQINEIEKGETVSYG
RRFTAERHSRIATLPVGYADGIRRSLGYGNAKVNINGQLAATVGTICMDMMMVDVTDIDC
KAGDEVIIFGENPSLSKFAEWMQTIPYEVLTSISSRVQRVYYQE
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaaaacaaattataatttaggagaattagcacagatacttaatgcaaagcta
atcggagacaaagagcaaactatcgaagaatattatttcgatacaaggaccatcgtttgc
ccaaccaatggtttatttataacgttaaaaggcttgcaaaaaagtggtgcttattatttg
gatgaagcttatcagaaaggaatcagaagttttttggtttcctctattccagcccaaccc
aaagacggtgccaattatcttttggtacaggacgtccttgttgctttacaaatgttagcc
aaacatcaccggcaacgttttactttacctctctttggtattacaggttctaacggaaaa
acggtggtaaaagaatggctgtaccaactcctctggaacgaatacaatattgcccgaagt
ccgaaaagttacaattcgcaactaggagttcctttttcggttttattgatagacgaacat
aacgatttaggaattttcgaagcaggcgtatctcaacccaatgaaatgcaagctttacgt
tgcattctgcaacctactacagcgattttaaccaatattggttctgcacatttagaaaac
tttctcgatagacgatctcttgcactcgaaaaaatacaacttctagaggcggcccaagaa
attatttatcctgcagatgatgaattgattgaagaacttatttcgtctaaccctgttttt
gattcgaaacgaagaattacgtttggtaaatcagacaaagcaaccgttcaactcaaacaa
taccagactattaatgggcaaagttctatagatattgaaatttcaggagttttatttaac
ataattatacctttcacagatcaagcctcgatacaaaacgctctaatttgctgtgcatca
atatattcactcaataaaaatctaaacgattacaaaagtaagtttgagaaacttttaccg
atagaaatgcgtttggaaataaaagaggcgattaacaacagtatcttaatcaacgatgca
ttcaactcggatctgatatccctaaaaaatgcattggatacgttggctcaacaatcgaga
gaaagaaaagttttggtgttaaccgatatattgcaatcaaaattagcagacaaagaatta
taccaaaagacagccgaattagttaatccgtaccattttacagaaatcgttttgattggc
gaaaaaatatctgcctataaaaaattattcaaatcttatgtaagagcattctcttctacc
gatgattttcttcgacatatccaacatgaaaatatacacaatgaagttattttactgaaa
ggatctagaatttttcagttagaaaaaatatcagattatatcgaaaaaaaatcacatgat
acggttctggaaataaatttagaacatctcgaacataacatacaaacatatcgatcattg
ttaaaacctgaaaccaaaataatggctatggtaaaagcaaatagttacggtataggaagt
ttcgagattgcaaatgttctacaacaaatgaaagtaaattttttgggagttgccattgcc
gacgagggtaaagagttacgcaaagccggtatttctactccgattattgtgatgaatccc
gaacaacattcgtatgcaacagtaatcgattaccaattagaacccgaaatatataccgca
agggtattgcaacttttcttgcagaaactacaagaaaaacaaatttcgcaaccttttcct
attcatataaaattagaaaccgggatgaatcgtttgggttttaaaccgaatcaattagac
gagctgattgaaatacttcgatcgaccaatctcgtttatgtacgttcaattttcagtcat
ttagctaccgctgatataccaactgaaaaagattatgctcaacaacagtttggagttttt
aattcatcttaccattatattaccgataaaataggttattacccaataaaacacattctc
aattcacccggaattgttgcctatccccaacaccaatacgacatggtacgactagggatt
ggtatgtacggctattgcgaatacagcgattttatgcaaaaattagaaaacgttgtgcaa
tttaagacggttatttcacaaattaatgaaatcgaaaaaggtgaaacggtgagttatgga
agacgctttacagccgaaagacattcccgaatcgctactttaccagttggttatgcagat
ggaattcgacgaagcttgggttacggaaatgcaaaggtaaatatcaatggacaattggct
gcgacggtcgggacgatatgcatggatatgatgatggtagatgtaacggatattgattgc
aaagcaggcgatgaggtaattatttttggcgaaaacccatctcttagtaaatttgccgaa
tggatgcaaaccataccttatgaagttctcacgtcgatttcatcacgtgttcagcgcgtt
tattatcaagaatag

DBGET integrated database retrieval system