KEGG   Weeksella virosa: Weevi_1076Help
Entry
Weevi_1076        CDS       T01441                                 

Definition
(GenBank) riboflavin synthase, alpha subunit
  KO
K00793  riboflavin synthase [EC:2.5.1.9]
Organism
wvi  Weeksella virosa
Pathway
wvi00740  Riboflavin metabolism
wvi01100  Metabolic pathways
wvi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:wvi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Weevi_1076
Enzymes [BR:wvi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.9  riboflavin synthase
     Weevi_1076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lum_binding
Motif
Other DBs
NCBI-ProteinID: ADX67785
UniProt: F0P295
Position
complement(1133101..1133694)
Genome map
AA seq 197 aa AA seqDB search
MFTGIVEAVGHVRKIEKEEKNIHFWIEAPFVDELKIDQSVAHNGVCLTVVDFKDNLYKVT
AIDETLSKTNLARWQINDLVNLERCMPLNARLDGHIVQGHVDQIGQLINIEEQQGSFLLT
IAYDEEKSGNVTVEKGSICLNGISLTVVNSKIGEFSVAIIPYTWEFTNLHQLNLGDELNL
EFDIVGKYIKRLIPNIN
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtttacaggaatcgtagaggcagtcggtcatgtaagaaaaatagaaaaagaagaaaaa
aatattcacttttggattgaagctccctttgtagatgaactaaaaattgatcaaagtgta
gcccacaatggcgtatgtctaacagtggttgattttaaagataatctctataaagttact
gcaatcgacgagacactctccaaaactaatcttgcacgttggcaaattaatgatttggtc
aacttagaacgctgtatgcctctcaacgctcgcttagacggacacatcgtgcaaggacat
gtagaccagataggtcaattaatcaacatagaagagcaacaaggaagttttcttttaaca
attgcctatgatgaagaaaaaagtggaaatgttacagtagaaaaaggatcaatctgtctc
aacggaattagtctaacagttgtaaatagtaaaattggagaattttcagtagcaattatt
ccgtacacttgggagtttacaaacctacatcaattgaatcttggcgatgaactaaatctt
gaatttgatattgttgggaaatacatcaaacgattaataccgaatataaactaa

DBGET integrated database retrieval system