KEGG   Weeksella virosa: Weevi_1207Help
Entry
Weevi_1207        CDS       T01441                                 

Definition
(GenBank) Acid phosphatase
  KO
K14379  tartrate-resistant acid phosphatase type 5 [EC:3.1.3.2]
Organism
wvi  Weeksella virosa
Pathway
wvi00740  Riboflavin metabolism
wvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wvi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Weevi_1207
Enzymes [BR:wvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     Weevi_1207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos PhoD
Motif
Other DBs
NCBI-ProteinID: ADX67916
UniProt: F0P304
Position
complement(1276546..1277538)
Genome map
AA seq 330 aa AA seqDB search
MKLKKIFSVLFIIIIHLLYGQQKADHTVVLSVSQHHDILPEKNGLSFLAIGDFGRHGAFT
QKEVARDMGAVADILDLDFTIAVGDNFYPSGVQSTKDYQWISSFESIYTHHSLHNPWYVA
LGNHDYEGNIQAQIDYTKISRRWEMPETYYEKLIEIDQNKFLQLLIIDTNPFVSKYQKNT
AKYLAIDKQDTQEQLAWLRSKLENKDPKIVWRIVVGHHPLYSGGKRKEAKETIEIKIFVE
PIFDKYQVDAYICGHEHDLQIIRKNNKKLTQFLSGAGSELRETGKTEGTLFADSVPGFMA
FTLSENILKAYIIQSQKDSYKVIYKTEIKK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaaaaaaaattttctccgtattatttataataattatacacctactgtatggt
cagcaaaaagctgatcatacagttgttttatctgtatcacaacatcatgacattctacca
gaaaaaaatggcctatcgtttttggcaataggagattttggtcgccacggagcattcact
caaaaagaagtagcacgagatatgggagctgttgcagatatattagatcttgattttact
attgctgttggtgataatttttatccttcgggagttcaaagtacaaaagattatcagtgg
atttcttcgttcgaaagtatctacacccaccattctctacacaatccgtggtatgttgcc
ttgggtaatcacgattacgaaggcaatatccaggcacagatagattataccaaaatatcg
agacgatgggaaatgcccgaaacgtattatgaaaaactaatcgaaattgaccaaaataag
tttttacagttattgattattgacactaatccttttgtatcaaaatatcaaaaaaacacg
gctaaatatttagcaatcgacaagcaagatacacaagaacagttagcttggctaaggtct
aaactagaaaataaagatcctaaaattgtttggcgaatagtagttggtcatcatcctttg
tattcgggcggaaaacgtaaggaagcaaaagaaacaatagaaataaaaatatttgtcgaa
cctatattcgacaaataccaagtagatgcctatatttgtggacacgagcacgatttgcaa
atcattagaaagaacaataaaaaactaactcaatttttatccggtgcgggcagtgaacta
cgtgaaaccggtaaaacagaagggactttgtttgccgactcagttccaggattcatggct
tttaccttatcagagaatattttaaaagcatatattattcaatctcagaaagatagctat
aaagttatttataaaaccgaaataaaaaaatga

DBGET integrated database retrieval system