KEGG   Weeksella virosa: Weevi_1236Help
Entry
Weevi_1236        CDS       T01441                                 

Definition
(GenBank) 6,7-dimethyl-8-ribityllumazine synthase
  KO
K00794  6,7-dimethyl-8-ribityllumazine synthase [EC:2.5.1.78]
Organism
wvi  Weeksella virosa
Pathway
wvi00740  Riboflavin metabolism
wvi01100  Metabolic pathways
wvi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:wvi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Weevi_1236
Enzymes [BR:wvi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.78  6,7-dimethyl-8-ribityllumazine synthase
     Weevi_1236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DMRL_synthase
Motif
Other DBs
NCBI-ProteinID: ADX67940
UniProt: F0P328
Position
1308296..1308790
Genome map
AA seq 164 aa AA seqDB search
MATENKNLSQYDKSTLPSGKGKCFAIVTSEWNNHITFNLRDGVKDTLIDLGVDEKDILMM
HVPGSFELVYGADKIAQKYPNLDGIIAVGCVIRGETAHFDYVCQGVTQGIQFLNQKHPMP
IIFCLLTDENEQQSIDRSGGKHGNKGVEAGVAAVIMADFKSQLS
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgaaaataaaaatctatcacagtacgataaaagcacactaccatcaggtaaa
ggaaaatgctttgcaatcgtaacctcagaatggaataatcacataacattcaatctaaga
gatggcgtaaaagatacgttgatagatttgggagtagatgaaaaagatatcttaatgatg
catgtgccaggtagtttcgagttggtctatggagccgataaaatcgcacaaaagtaccca
aatctcgacggaataatagcggtaggatgcgtcataagaggagaaaccgcacactttgat
tatgtctgccaaggcgttacccaaggtattcaatttcttaatcagaaacatccaatgccc
ataatattctgtttattaactgatgaaaacgaacaacaatcgattgatcgttcgggcgga
aaacatgggaataaaggagtagaagcaggtgttgcagctgtaatcatggccgatttcaaa
tctcaattatcgtaa

DBGET integrated database retrieval system