KEGG   Weeksella virosa: Weevi_1911Help
Entry
Weevi_1911        CDS       T01441                                 

Definition
(GenBank) Cysteine desulfurase
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
wvi  Weeksella virosa
Pathway
wvi00730  Thiamine metabolism
wvi01100  Metabolic pathways
wvi04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:wvi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Weevi_1911
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    Weevi_1911
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:wvi03016]
    Weevi_1911
   03029 Mitochondrial biogenesis [BR:wvi03029]
    Weevi_1911
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:wvi02048]
    Weevi_1911
Enzymes [BR:wvi01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     Weevi_1911
Transfer RNA biogenesis [BR:wvi03016]
 Eukaryotic type
  tRNA modification factors
   Thiolation factors
    Weevi_1911
 Prokaryotic type
    Weevi_1911
Mitochondrial biogenesis [BR:wvi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    Weevi_1911
Prokaryotic defense system [BR:wvi02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   Weevi_1911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Beta_elim_lyase Pyridoxal_deC MtrH
Motif
Other DBs
NCBI-ProteinID: ADX68596
UniProt: F0P112
Position
complement(2044122..2045282)
Genome map
AA seq 386 aa AA seqDB search
MQKVYLDNAATTKLDPAVIEEMVHAMKNVYGNPSSTHIFGREAKALLELSRKKIASFVNV
SPAEIYFTSSGTESNNTVIRSCVKDLGVERIITTSIEHKCVQETIKELESTLKVEVIRLN
LDEKGRIDYNQFSELITDQSKKTLVSLMHANNEIGNLLNIELISKLCQENNALFHTDTVQ
TVGHYPLDFEALGIDFASCSAHKIHGPKGSGFLYAKKSTHIKPLITGGGQERNMRSGTEN
VYGIVGLAKALELCVENMDQYQKKIKDLKAYAMDELKKEIPTIEFNGLSDDLDESLYTVL
SLKLPFQDSLIGFELELAGIAVSQGSACSSGAATASSVMSAIYSEDELQNFTPLRVSFSH
FNTKDDIDILVKKLKSIAEKHLNVEA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagtatatttggacaatgcagccactacgaaattagacccagctgttatagag
gaaatggttcatgccatgaaaaatgtttacggaaacccatcttcaacccacatttttggt
agagaagcaaaagcattactcgaattgtcgcgaaagaaaattgcttcttttgtcaatgta
agtccagccgaaatatactttacttcttcgggaacagaatccaataataccgtaatccgt
tcttgtgtaaaagatttgggtgtcgagagaattattacaacttctatcgagcataagtgc
gtgcaagaaaccataaaagaattagaatctaccctaaaagtagaagttatacgacttaat
ctagatgaaaaaggtcgtatagattacaatcagttttcggagttaattacagatcaatct
aaaaaaaccttggtctcgttgatgcatgctaataatgaaatagggaatcttctaaatatt
gagcttatcagcaaattatgccaagaaaacaatgctctttttcatacagacaccgtccag
accgttggtcactatccattagatttcgaagctttaggaatagactttgcatcgtgttca
gcacataaaattcatggtccaaaaggtagtggatttttatatgccaaaaagtctacgcat
ataaaacctctaatcaccggtggcggacaagagagaaatatgcgttcgggaaccgaaaat
gtatatggtatagtaggtttggcaaaagcgctggaattgtgcgtagaaaacatggatcaa
tatcaaaaaaagatcaaagatctgaaagcatatgcaatggacgaactgaaaaaagaaatt
cctactatcgagttcaatggtttgagtgatgatttggatgaaagtctttatactgttttg
agtcttaagttgccttttcaagattcgttaatcggtttcgagcttgagttggctgggatc
gctgtttctcaagggagtgcgtgtagttccggtgcagcaacagcttcgagcgtaatgtct
gcaatttacagtgaagatgaattacaaaatttcacgccacttcgggtttcatttagccat
ttcaataccaaagatgacattgatattttagtgaaaaaattaaaatctattgccgaaaaa
catctcaatgtagaagcttaa

DBGET integrated database retrieval system