KEGG   Weeksella virosa: Weevi_1938Help
Entry
Weevi_1938        CDS       T01441                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
wvi  Weeksella virosa
Pathway
wvi00071  Fatty acid degradation
wvi00072  Synthesis and degradation of ketone bodies
wvi00280  Valine, leucine and isoleucine degradation
wvi00310  Lysine degradation
wvi00362  Benzoate degradation
wvi00380  Tryptophan metabolism
wvi00620  Pyruvate metabolism
wvi00630  Glyoxylate and dicarboxylate metabolism
wvi00640  Propanoate metabolism
wvi00650  Butanoate metabolism
wvi00900  Terpenoid backbone biosynthesis
wvi01100  Metabolic pathways
wvi01110  Biosynthesis of secondary metabolites
wvi01120  Microbial metabolism in diverse environments
wvi01200  Carbon metabolism
wvi01212  Fatty acid metabolism
wvi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:wvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Weevi_1938
   00630 Glyoxylate and dicarboxylate metabolism
    Weevi_1938
   00640 Propanoate metabolism
    Weevi_1938
   00650 Butanoate metabolism
    Weevi_1938
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Weevi_1938
   00072 Synthesis and degradation of ketone bodies
    Weevi_1938
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Weevi_1938
   00310 Lysine degradation
    Weevi_1938
   00380 Tryptophan metabolism
    Weevi_1938
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Weevi_1938
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Weevi_1938
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Weevi_1938
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:wvi04147]
    Weevi_1938
Enzymes [BR:wvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Weevi_1938
Exosome [BR:wvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Weevi_1938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ADX68622
UniProt: F0P1A8
Position
2078184..2079362
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVSAIRTPMGSFLGSLSTIPATKLGSIAIKGALDKINLSAEHVDEVYMGNVLQAG
EGQAPAKQAMIDAGIPNTVPATTVNKVCASGMKAVMLAAQAIRLGDADVVVAGGMENMSM
TPFYSATARLGNKYGNTSLNDGIVQDGLQDAYSKEMMGVFGDATAAKYQITREQQDAFAI
ESYKKSAAAWEAGKFDNEIVPVEIPQRRGDAILFKEDEEYKNVRYEKIPELRAVFSKDGT
VTAANASTINDGASALVLMSAEKAQELGLKPLAKVTAYADAAHEPEWFTTAPAKAVEKLL
KKAAINVDDVDYWEFNEAFSVVGLVNTQLLNIDASKVNVNGGAVSLGHPLGNSGSRILVT
LLNVLEQNNAKIGVAAICNGGGGASAMLIEKL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagtaattgtctctgcaataagaacaccgatggggtcttttttgggaagt
ttatcaacaattcctgcaacaaaattaggaagtatcgcaataaaaggggccttagacaaa
atcaacttatcagcagaacatgtagatgaagtttatatggggaatgttcttcaggctggt
gaaggacaggcacccgcaaaacaagcaatgatagacgctggaattcccaatacagtacct
gcaaccacagttaataaggtttgtgcttcaggaatgaaggcagttatgttagctgcacaa
gcgattcgtttgggtgatgccgatgtcgttgttgccggcgggatggaaaacatgtcgatg
acaccattctattctgctacagcacggttaggaaacaagtacggaaatacttcgctaaat
gatgggatagtacaagacggtttacaagatgcttactcaaaagaaatgatgggagttttt
ggagatgctacagccgcaaaataccaaattacaagagagcaacaagatgcttttgctata
gaatcttataaaaaatctgccgctgcttgggaagcaggaaaatttgataatgaaattgtt
cctgtagaaattccacaacgccgtggagatgctatccttttcaaggaagatgaagagtat
aaaaatgtacgctatgaaaaaattccagaactgcgtgctgtcttctccaaagacggaacc
gtaacagctgcaaatgcgtcgaccatcaacgacggtgcctcggctttggtactgatgtct
gccgaaaaagcacaagaattaggattgaaacctttagcaaaagttacagcctatgcagac
gcagcccacgaaccagaatggtttacaacagcacccgccaaagctgtagaaaaattattg
aaaaaagcagccatcaatgtagacgatgtagattattgggagtttaatgaagctttttct
gtagtaggattagtcaacacacaattgctaaacattgacgcatcgaaagtaaatgttaac
ggaggtgcagtttctttaggtcatccattaggaaattctgggtcgagaattttggtaact
ttactgaatgtattagaacaaaataatgcgaagataggagttgcagcaatctgtaatgga
ggcggaggagcttcggcaatgttaatcgaaaaattataa

DBGET integrated database retrieval system