KEGG   Candidate division WWE3 bacterium RAAC2_WWE3_1: P147_WWE3C01G0741Help
Entry
P147_WWE3C01G0741 CDS       T02947                                 

Definition
(GenBank) hypothetical protein
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
wwe  Candidate division WWE3 bacterium RAAC2_WWE3_1
Pathway
wwe00051  Fructose and mannose metabolism
wwe00520  Amino sugar and nucleotide sugar metabolism
wwe01100  Metabolic pathways
wwe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:wwe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    P147_WWE3C01G0741
   00520 Amino sugar and nucleotide sugar metabolism
    P147_WWE3C01G0741
Enzymes [BR:wwe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     P147_WWE3C01G0741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer PSA_CBD CHASE4
Motif
Other DBs
NCBI-ProteinID: AHB40648
UniProt: V5RTY6
Position
726067..727146
Genome map
AA seq 359 aa AA seqDB search
MKFIVSAGGQGTKLWPYSRENNPKQFQKILNGESLFSYNVKTLLRKYPANDILISTKDRY
VKIAREQVPQIPLENYILEPDTPKNRGPADGLAIVYLDVKFPGEPFMIVQSDCVRIPENN
YLLLIETAEKLVKEYKKFISGGIAVTYPDLGVDYLKLGRKIHSYGNVDVYEAKEFVDRRS
NYVETKELIENFNVVKHSNHNCWYPQLLLEAYERYKPDWYTALMQIRKIISETNSLEGVS
AIYQGMEAGATEIVTRHLFKDALILQLNYNWVDIGTWNSLYEYVARKDQVYKEGNVIALD
SKSSLIKSDNPDKLIAVFGLKDMVVVDTADTLLIVPKDKTDKIKDIQDELRSKKLDKYL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttatcgtcagcgccggaggccagggcacgaaactatggccatacagcagagaa
aataaccccaagcaatttcagaaaatcttaaacggagaatcgcttttttcatacaacgta
aaaactttacttagaaaataccccgcaaacgatattcttatttcgaccaaagaccggtac
gtaaaaatcgcgcgtgagcaggttccgcagatacctttggaaaattatattctagagccg
gacacacctaagaacagaggtcccgccgacggactagcaattgtttacctcgacgttaaa
tttccgggcgaaccctttatgatcgttcagtcggattgcgtcagaattcccgaaaacaat
tatctattattaatagaaactgccgaaaagctagtgaaagaatataaaaagtttatttcg
ggcggaattgctgtcacataccccgaccttggggttgactacctaaagctcggcagaaaa
atccattcttatgggaacgtcgatgtttatgaagcaaaagaattcgttgaccgccgttca
aattatgttgaaacgaaagaactcatcgaaaattttaacgttgtaaagcacagcaaccac
aactgctggtacccacaactgctgttagaagcgtatgaaagatacaaaccggattggtat
acggcgctaatgcagattagaaaaattattagtgaaacgaacagtctcgagggcgtttca
gctatttatcagggaatggaagccggtgcaaccgaaatcgtcacccgccatttatttaaa
gacgcgctgattttgcagctcaattataattgggtcgacatcggtacgtggaattcgctt
tacgagtatgtcgcgcgtaaagatcaggtgtacaaagagggaaacgtgattgccctggac
tcaaaaagctctttgattaaaagtgacaatcccgacaaactgatagcggtgttcggacta
aaggatatggtggttgtagatactgcggacacgctgttgattgtgcctaaagataaaacc
gacaaaatcaaagacattcaggacgagctgcgcagtaaaaagctggacaagtatttgtag

DBGET integrated database retrieval system