KEGG   Xanthomonas citri pv. citri 306: XAC0213Help
Entry
XAC0213           CDS       T00084                                 

Gene name
yfcY
Definition
(GenBank) acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac00071  Fatty acid degradation
xac00072  Synthesis and degradation of ketone bodies
xac00280  Valine, leucine and isoleucine degradation
xac00310  Lysine degradation
xac00362  Benzoate degradation
xac00380  Tryptophan metabolism
xac00620  Pyruvate metabolism
xac00630  Glyoxylate and dicarboxylate metabolism
xac00640  Propanoate metabolism
xac00650  Butanoate metabolism
xac00900  Terpenoid backbone biosynthesis
xac01100  Metabolic pathways
xac01110  Biosynthesis of secondary metabolites
xac01120  Microbial metabolism in diverse environments
xac01130  Biosynthesis of antibiotics
xac01200  Carbon metabolism
xac01212  Fatty acid metabolism
xac02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XAC0213 (yfcY)
   00630 Glyoxylate and dicarboxylate metabolism
    XAC0213 (yfcY)
   00640 Propanoate metabolism
    XAC0213 (yfcY)
   00650 Butanoate metabolism
    XAC0213 (yfcY)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XAC0213 (yfcY)
   00072 Synthesis and degradation of ketone bodies
    XAC0213 (yfcY)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XAC0213 (yfcY)
   00310 Lysine degradation
    XAC0213 (yfcY)
   00380 Tryptophan metabolism
    XAC0213 (yfcY)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XAC0213 (yfcY)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XAC0213 (yfcY)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    XAC0213 (yfcY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xac04147]
    XAC0213 (yfcY)
Enzymes [BR:xac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     XAC0213 (yfcY)
Exosome [BR:xac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XAC0213 (yfcY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AAM35105
UniProt: Q8PQV8
Position
260718..262013
Genome map
AA seq 431 aa AA seqDB search
MPGQPMPAARPVAILGGVRIPFCRQNTAYADVGNLGMSVRTLGALVERFGLHGQQLGEVA
MGAVIKHSADWNLAREAALSSGLSPLTPGITLQRACGTSLDSVITIANKIALGQIDSGIG
GGSDTTSEVPIVYGKKLRARLLAANRAKATGDKLRALLRGFKLAELKPEFPGVAEPRTGK
SMGDHCEDMAKEWNISRDSQDEWAVASHHKLAAAYERGFFDALIAPFRGVSRDNILRADT
SLEKLATLRPAFDKTSGRGTLTAANSTPLTDGAAAVLLSSEAWALAHGHTPMAYLRDAQV
AAVDFVHGEGLLMAPTIAVPQMLARQGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCR
NRLGLDAPLGRIDPDKINPLGSSLATGHPFAATGARVVATAAKQLEERGGGRALISICTA
GGMGVVAIVER
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtcaaccgatgcccgcagcccgtcccgtcgccattctgggcggcgttcgtatc
ccgttctgtcgtcagaacaccgcctacgcggacgtgggcaacctgggcatgtcggtgcgc
acgctgggcgcgttggtcgagcgcttcgggttgcatgggcagcaattgggcgaagtggcg
atgggcgcggtgatcaagcactccgcggactggaacctggcgcgcgaggcggcgctgtcg
tcgggtctgtcgccgctgacgccgggcatcaccctgcagcgcgcctgcggcaccagcctg
gattcggtcatcaccatcgccaacaagatcgcgctggggcagatcgactcgggcatcggc
ggcggctccgacaccacctccgaagtgccgatcgtgtacggcaagaagttgcgcgcacgg
ctgctggccgccaaccgcgccaaggccaccggcgacaagctcagggcgctgctgcgcggc
ttcaagctggccgagctcaagcccgaattccccggcgtggccgagccgcgcaccggcaag
agcatgggcgaccattgcgaggacatggccaaggaatggaacatctcgcgcgattcgcag
gacgaatgggcggtggcctcgcaccacaagctggccgctgcctatgagcgcggtttcttc
gacgcgctgatcgcgccgttccgcggcgtctcgcgcgacaacatcctgcgcgccgacacc
tcgctggaaaaactcgcgaccttgcgaccggccttcgacaagacctccggccgtggcacg
ttgaccgctgccaattccaccccgctcaccgatggcgccgccgcggtgctgctctccagc
gaagcctgggcgttggcgcatggccacacgccgatggcctacctgcgcgatgcacaggtg
gcggcagtcgacttcgtgcatggcgaaggcctgctgatggcgcccaccattgcggtgccg
cagatgctggcgcgccagggcctgaccctgcaggacttcgatatctacgaaatccacgag
gccttcgccgcgcaggtgctgtgcacgctgcgcgcgtgggagagcgaggactactgccgc
aaccggctgggcctggacgcgccgctgggccgcatcgacccggacaagatcaatccgctg
ggctcgtcgctggccaccggccatccattcgccgccactggcgcacgcgtggtggccacc
gctgccaagcagttggaagagcgcggcggcggccgcgcgttgatttcgatctgcaccgcc
ggcggcatgggcgtggtggccatcgtcgagcgctga

DBGET integrated database retrieval system