KEGG   Xanthomonas citri pv. citri 306: XAC0244Help
Entry
XAC0244           CDS       T00084                                 

Definition
(GenBank) pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
xac  Xanthomonas citri pv. citri 306
Brite
KEGG Orthology (KO) [BR:xac00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xac03016]
    XAC0244
Enzymes [BR:xac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     XAC0244
Transfer RNA biogenesis [BR:xac03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    XAC0244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AAM35136
UniProt: Q8PQS8
Position
292046..292780
Genome map
AA seq 244 aa AA seqDB search
MSISPKHLQILYQDDVLAVVDKPAGLMVHDSKLARGEDDFLADRLREQLGKPIFLVHRLD
RATSGCLLLAFDRDSASALGKALMAGEVEKQYLTVCRGWPAEERFIVDHDLDGGPGKPVK
KPAVTHFQRLATGELEIPSTGFTTSRYALLRCQPQTGRFRQIRRHMKHLSHHMVGDTSHG
DGRHNRSFRMLGIHRMLLHAERLEFPHPADGRRIGVTAPLDVEFSKACALFGWEMAGLGV
MQTA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatatcccccaaacatctgcagattctctaccaggacgatgtcctggccgtcgtc
gacaaacccgccggcctgatggtccatgacagcaagctggcgcgtggagaggacgacttc
ctggccgaccgcctgcgcgagcagctgggcaagccgatctttttggtgcaccggctcgac
cgcgccaccagcggctgcctgctgttggccttcgatcgcgacagcgccagtgcgctgggc
aaggctttgatggccggcgaggtggagaaacagtatctgaccgtctgtcgcggctggccg
gccgaggagcgcttcatcgtcgaccatgacctggacggcggtccgggcaagccggtcaag
aagccggcagtgacgcatttccagcgtctggccaccggcgagctggagattccttccacc
gggttcaccacctcgcgctacgcactgctgcgctgtcagccgcaaaccggccgcttccgg
cagattcgccggcatatgaagcatctgtcgcatcacatggtcggcgacaccagccacggc
gacggccgccacaaccgcagtttccgcatgctcggcatccaccgcatgttgctgcacgcc
gaacgcctggaatttccgcatccggccgatggcaggcgcatcggcgtcaccgcgccgctg
gatgtcgaattttccaaggcctgcgcgttgtttgggtgggagatggcggggttgggagtc
atgcagacggcgtga

DBGET integrated database retrieval system