KEGG   Xanthomonas citri pv. citri 306: XAC0862Help
Entry
XAC0862           CDS       T00084                                 

Gene name
apaG
Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
xac  Xanthomonas citri pv. citri 306
Brite
KEGG Orthology (KO) [BR:xac00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    XAC0862 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AAM35750
UniProt: Q8PP26
Structure
PDB: 

Position
complement(1023878..1024261)
Genome map
AA seq 127 aa AA seqDB search
MQDDPRYRVEVEVSPRFLAHQSTPDEGRYAFAYSIRIQNAGAVPARLVARHWQITDGNGR
TEQVDGEGVVGEQPWLRPGEAFHYTSGVLLETEQGQMQGHYDMVADDGTEFIAPIAAFVL
SVPRTLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatgatccgcgctaccgggtcgaggtcgaggtatcgccccgcttcctcgcccat
caatccaccccggacgaaggccgctatgcctttgcctacagcatccgcatccagaatgcg
ggcgcggtgcctgcgcgcctggtcgcgcgccattggcagatcaccgatggcaacggacgc
accgagcaggtggatggcgaaggggtggtcggcgaacagccgtggctgcgcccgggcgaa
gcgttccattacacctctggcgtactgctggagaccgagcagggacagatgcaaggccac
tacgacatggtggccgacgatggcaccgaatttatcgccccgatcgccgccttcgtgctg
agcgtgcccaggacgctgcactga

DBGET integrated database retrieval system