KEGG   Xanthomonas citri pv. citri 306: XAC1378Help
Entry
XAC1378           CDS       T00084                                 

Gene name
desC
Definition
(GenBank) delta 9 acyl-lipid fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac01040  Biosynthesis of unsaturated fatty acids
xac01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    XAC1378 (desC)
Enzymes [BR:xac01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     XAC1378 (desC)
Lipid biosynthesis proteins [BR:xac01004]
 Desaturase
  First
   XAC1378 (desC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase Rer1
Motif
Other DBs
NCBI-ProteinID: AAM36249
UniProt: Q8PMP8
Position
complement(1586408..1587304)
Genome map
AA seq 298 aa AA seqDB search
MDSQTDEPLDEARADRIDWLRAVPFIALHLACLAVFWVGASWFAVGMAVALYALRMFALT
GFYHRYFSHRAFKTSRVLQFVFAAIGATCVQRGPLWWAAHHRNHHRHTDTGRDPHSPAQH
GFWWSHTGWFLTPRNFRTDWEVIPDLRRFAELRFLDRFDIVMPVLLALGLYLLGDWLAVA
APALKTSGAQLLVWGFVISTVALFHATFTINSLAHRFGSRRFDTRDDSRNNWLLALLTFG
EGWHNNHHFFPGSARQGLRWWEYDMTWYGLTAMSWVGLVWDLKPMPKLLTQRAERVKR
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtggattcgcaaaccgacgagcccctggacgaagcgcgtgccgatcgcatcgactggcta
cgtgcggtgcctttcatcgccttgcacctggcctgcctggcggtgttctgggtcggtgcg
tcctggtttgcggtgggcatggcggtggcgttgtacgcgctgcgcatgttcgcgctcacc
ggtttttaccaccgctacttctcgcaccgcgcgttcaagacgtcgcgggtgctgcaattc
gtgttcgccgccatcggggccacctgcgtgcagcgcgggccgttgtggtgggcggcgcat
catcgcaaccaccatcgacataccgacaccggccgcgatccgcattcgccggcgcagcac
ggcttctggtggagccataccggctggttcctgaccccgcgtaatttccgcaccgactgg
gaagtgattcccgacctgcgccgctttgccgaactgcgctttctggaccgcttcgacatc
gtgatgccggtgctgctggcgctgggcctgtacctgctcggcgactggctggcagtggct
gcgcccgcgctgaaaaccagcggcgcgcagttgttggtgtggggctttgtgatctccacc
gtggcgttgttccatgccaccttcaccatcaactcgctggcgcatcgtttcggcagccgg
cggttcgacacccgcgacgacagccgcaacaactggctgctggccttgctcaccttcggc
gaaggctggcacaacaatcaccatttcttcccaggctcggcgcgccagggattgcgatgg
tgggaatacgacatgacctggtacggactcaccgcgatgtcgtgggtggggctggtgtgg
gacctcaagccgatgccgaagctgctcacccagcgcgccgaacgggtgaagcgatga

DBGET integrated database retrieval system