KEGG   Xanthomonas citri pv. citri 306: XAC1603
Entry
XAC1603           CDS       T00084                                 

Gene name
haaO
Definition
(GenBank) 3-hydroxyanthranilate 3,4-dioxygenase
  KO
K00452  3-hydroxyanthranilate 3,4-dioxygenase [EC:1.13.11.6]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac00380  Tryptophan metabolism
xac01100  Metabolic pathways
xac01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:xac00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    XAC1603 (haaO)
Enzymes [BR:xac01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.6  3-hydroxyanthranilate 3,4-dioxygenase
     XAC1603 (haaO)
SSDB
Motif
Pfam: 3-HAO Cupin_2 AraC_binding zf-ribbon_3 DZR Cupin_1
Other DBs
NCBI-ProteinID: AAM36471
UniProt: Q8PM31
Position
complement(1852539..1853069)
AA seq 176 aa
MLTPPINLHAWIEEHRHLLKPPVGNKCIQQDGFIIMVVGGPNARTDYHYDEGPEWFFQLE
GEMVLKVQDEGVARDIPIRAGEVFLLPPKVPHSPQRADGSIGLVIERERLPTEQDGLQWY
CPQCNHKLYEAMFPLKNIETDFPPVFDRFYRSPALRTCSQCGHLHPAPERYATVEG
NT seq 531 nt   +upstreamnt  +downstreamnt
atgctgaccccgccaatcaacctgcacgcctggatcgaggaacaccgccacctgctcaaa
ccgccggtgggcaacaagtgcatccagcaggatggcttcatcatcatggttgtcggggga
ccgaacgcgcgcaccgactatcactacgacgaaggcccggagtggttcttccagctcgag
ggcgaaatggtgttgaaggtgcaggacgagggcgtggcgcgcgacatcccgatccgtgcc
ggcgaagtctttctgctgccacccaaggtaccgcattcgccgcaacgcgcggacggctcg
atcggcctggtgatcgaacgcgagcgcctgcccaccgagcaggacggcctgcaatggtat
tgcccgcagtgcaatcacaagttgtatgaagcgatgtttccgctaaaaaacatcgaaacc
gacttcccgccggtgttcgatcgcttctaccgctcgcccgcactgcgcacctgttcgcag
tgcgggcacctgcatcctgcgcctgagcgctatgccacggtcgagggttga

DBGET integrated database retrieval system