KEGG   Xanthomonas citri pv. citri 306: XAC1684Help
Entry
XAC1684           CDS       T00084                                 

Gene name
cycA
Definition
(GenBank) cytochrome C2
  KO
K08738  cytochrome c
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xac00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XAC1684 (cycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 FixO
Motif
Other DBs
NCBI-ProteinID: AAM36551
UniProt: Q8PLV5
Position
complement(1941621..1941962)
Genome map
AA seq 113 aa AA seqDB search
MLAGALPVPSAYAADGANVFLTECGECHSVKPGKNKKGPSLFGVAGRPAGTVADFGGYSD
ALKNSKWTWTPAQLKTYLSQSSSKALPGTKMKYDGLDDPKELDALIAYLNTLK
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgctggcaggcgcactgcctgtgccctcggcatacgctgccgacggcgccaacgtcttc
ctcaccgaatgcggtgaatgccacagcgtcaaaccgggcaagaacaagaagggcccatcg
ctgttcggcgtggcaggacgccctgccggtaccgtcgccgacttcggcggttattccgac
gcgctcaagaacagcaagtggacctggaccccggcccagctcaagacctatctatcgcaa
tcctcgtccaaggcgctgccgggcaccaagatgaaatacgacggcctggacgaccccaag
gagctcgacgcgctgatcgcctacctcaacaccttgaaatag

DBGET integrated database retrieval system