KEGG   Xanthomonas citri pv. citri 306: XAC1711Help
Entry
XAC1711           CDS       T00084                                 

Gene name
pitA
Definition
(GenBank) transport protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
xac  Xanthomonas citri pv. citri 306
Brite
KEGG Orthology (KO) [BR:xac00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    XAC1711 (pitA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 HTH_IclR Pilin_N
Motif
Other DBs
NCBI-ProteinID: AAM36578
UniProt: Q8PLS8
Position
1970822..1971949
Genome map
AA seq 375 aa AA seqDB search
MLTLVLVVILAALVFEFINGFHDTANSIATVVATKVLSPGWAVMLAAGMNLIGALTGTAV
ALTIASGLLNTNVVEVTPQVILCALLGGIIWNLITWWKGLPSSSSHALIGGLCGAGLAAA
HNDWDALIWSENIGNWAKNKGLLWKVFVPMITSPIAGFVLGIVVMVLLWAIIAGMSKIGG
PIGRLARPRWVNAFFGKAQIASAAYMGYAHGHNDAQKTMGIIAMTLIGAQSAGALDDLPS
WLSFLHPGTGLAAGAGIPMWIVLTCAVVMAAGTASGGWKIIKTLGHKMVKLHPIHGFAAE
TSSATVLTVAAHFGMPVSTTHSISTAIMGVGFAKNPRSLRLGVIERIVWAWILTIPAAGG
VAYLILTLFELLGWT
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgcttaccttagttctggtggtgatcctggccgcgttggtgttcgagttcatcaacggc
ttccacgacaccgccaactccatcgccaccgtggttgccaccaaggtgctctcgcccggt
tgggcggtgatgctggcagccggcatgaacctgatcggcgcgctgaccggcaccgccgtg
gcgctgacgattgcttctggcctgctcaacaccaacgtggtcgaggtcaccccgcaggtg
attttgtgcgcgctgctgggcggcatcatctggaacctgatcacctggtggaagggcctg
ccgtcgtcgtcctcgcatgccttgatcggcggcctgtgcggcgccggtctggccgcggcg
cacaacgactgggacgcgctgatctggtcggaaaacatcggcaactgggccaagaacaag
ggcctgttgtggaaggtgttcgtcccgatgatcacctcgccgatcgccggtttcgtgctc
ggtatcgtggtgatggtgctgctgtgggcgatcattgccggcatgtccaagataggcggc
ccgatcgggcggctggcgcggccgcgctgggtcaatgcgttcttcggcaaggcgcagatc
gcctcggccgcatacatgggctacgcgcacggccacaacgacgcgcagaagaccatgggc
atcatcgccatgaccctgatcggcgcgcagtcggccggcgcgctggacgacctgccgagc
tggttgtcgttcctgcatccgggcaccggccttgcggccggcgccggtatcccgatgtgg
atcgtgctcacctgcgcggtggtgatggctgcaggtaccgcgtcgggcggttggaagatc
atcaagacgctcggccacaagatggtcaagctgcatcccatccacggctttgccgcagaa
accagctcggcgacggtgctcaccgtggcggcgcatttcggcatgccggtgtccaccacg
cacagcatttccaccgccatcatgggggtgggtttcgccaagaatccgcgttcgctgcgg
ctgggcgtgatcgagcgcatcgtctgggcctggatcctgaccatcccggctgctggcggc
gtggcgtacctgatcctgacgctgttcgagctgttgggctggacctga

DBGET integrated database retrieval system