KEGG   Xanthomonas citri pv. citri 306: XAC2271
Entry
XAC2271           CDS       T00084                                 

Definition
(GenBank) hypothetical protein
Organism
xac  Xanthomonas citri pv. citri 306
SSDB
Motif
Pfam: DUF3487 DUF1616
Other DBs
NCBI-ProteinID: AAM37124
UniProt: Q8PKA4
Position
2655714..2656127
AA seq 137 aa
MPMAPQDTARDGLVAFLPHRLNRQPVVVRGLTADELWVCAGLSAAAGLLAGLPLAWITRS
IAMMPTMIVLGVAAGVFVGGGLLRRKKRGRPDIWLYRQMQWRLALRFPHGTGRPGTHRLV
TRSGYWTTRRTRPRGRP
NT seq 414 nt   +upstreamnt  +downstreamnt
atgccgatggcgccccaggacacggcacgcgacggcctcgtcgcattcctcccgcaccgc
ctcaaccgccagccggtggtggtgcgcgggctgacggccgacgagctctgggtctgcgcc
gggctgtccgccgccgccggcctgctcgcaggcctgccgctggcctggatcacgcgcagc
atcgcgatgatgcccacgatgatcgtcctgggcgtcgccgcgggcgtgttcgtcggcggc
ggcctcctgcgccgcaagaagcgcggccggcccgacatctggctgtaccggcagatgcag
tggcgcctggccctgcgtttcccgcacgggacgggacggcccggcacccatcgtctggtg
acgcgcagcgggtactggacgacacgccgcacgcggccgcggggccggccatga

DBGET integrated database retrieval system