KEGG   Xanthomonas citri pv. citri 306: XAC2273Help
Entry
XAC2273           CDS       T00084                                 

Definition
(GenBank) hypothetical protein
Organism
xac  Xanthomonas citri pv. citri 306
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2353 YabA TrbI CENP-F_leu_zip Macoilin
Motif
Other DBs
NCBI-ProteinID: AAM37126
UniProt: Q8PKA2
Position
2657818..2659290
Genome map
AA seq 490 aa AA seqDB search
MKSNGLLKWLMIPVAALLVFLGIHLTSGRSDQSAAGGGTAQLTPEEMKALGIDGDTPRDT
VATLVAQVKQLRGELQTAMGDNKNQRAENERLRQRDSSIDQRIQSALDGERGRLLQEREQ
AVGDKQQTQGMLQELQHKLDQLGGKGGSTDLPVGLGLEEGDGKGFGAQGAPGVRWVEPDD
ARPDAGKGPAGASGKGERFPMRFGPADGGTPGGGSVSAPESKAGAEPKPAKPVFTVPTNA
TLMGSVAMTALIGRVPIDGTVNDPYPFKVLIGPDNLTANGIDLPEVAGAVVSGTASGDWT
LSCVRGQIRSVTFVFRDGTIRTVPDEKGQGGTSGNRGNAGNGTAADGQGPILGGLGWISD
PHGIPCVSGERRSNAQQYLGSQALITAAGAGAASLIKSDSGSVAVVSNGNGSLGTVGISG
NEAMGRILAGGVQEMSQWVNKLYGQAFAAVYVPPGAQVAVHLEQPLQIDHDAQGRKVRHA
TGGSHAIDLD
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtaacggcctgctcaagtggctgatgattcccgtggcagcgctgctggtcttt
cttggcatccacctcacgtccggacgctcggaccagtccgccgcgggcggaggcaccgcc
cagctcacacccgaggaaatgaaggcgctcggcatcgacggcgacacgccgcgcgacacc
gtggcgacgctggtcgcgcaagtgaagcagctgcgcggcgaattgcaaacggccatgggc
gacaacaagaaccagcgcgcggagaatgagcgacttcgccagcgcgacagctccatcgac
cagcgcatccagtccgcgctcgacggcgagcgcggccgcctgctgcaggaacgcgagcag
gcggtcggtgacaagcagcagacgcagggcatgctgcaggaactgcagcacaagctcgac
caactcggcggcaagggcggctccaccgacctgccggtcggcctcggcctggaggaaggc
gacggcaagggcttcggtgcccagggcgccccgggcgtccgctgggtggagcccgacgat
gcgcgtcccgacgccggcaagggccctgcgggggcttcgggaaagggggaacgatttccg
atgcggttcgggccggccgatggtggcactcccggcggcggctccgtatcggcacccgaa
tccaaggccggcgcggagcctaagcccgccaagccggtcttcacggtccccacgaatgcg
acgctcatggggtcggtggcgatgacggctctgatcggccgcgtgcccatcgacggcacg
gtgaacgacccctacccgttcaaggtgctcatcggccccgacaacctcacggccaacggc
atcgatctgccggaagtagcgggcgccgtggtgagcggcacggcctccggcgactggacg
ctctcttgcgtgcgcggccagatccgctcggtcaccttcgtgttccgcgacggcaccatc
cgcacggtccccgacgagaagggccagggcggcaccagcggcaaccgtggcaacgcgggc
aacggcactgccgccgatggacagggcccgatccttgggggcctcggctggatcagcgat
ccgcacggcatcccctgcgtgagcggggagcggcgcagcaacgcgcagcagtacctgggc
tcgcaagcgctcatcacggccgccggggcgggcgcggcttcgctcatcaagagcgacagc
ggcagcgttgcggtggtgagcaacggcaacggctcgctgggcaccgtgggcatctccggc
aacgaggccatgggccgcattttggccggtggcgtgcaggagatgtcgcagtgggtgaac
aagctctacggccaggccttcgccgcggtgtacgtgccgcccggcgcccaggtcgccgtc
cacctcgaacaacccttgcagatcgaccacgacgcccagggccgcaaggtccgccacgct
accggaggaagccatgcgatcgacctggactga

DBGET integrated database retrieval system