KEGG   Xanthomonas citri pv. citri 306: XAC2716Help
Entry
XAC2716           CDS       T00084                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac00260  Glycine, serine and threonine metabolism
xac00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xac01100  Metabolic pathways
xac01110  Biosynthesis of secondary metabolites
xac01130  Biosynthesis of antibiotics
xac01230  Biosynthesis of amino acids
Module
xac_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XAC2716 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XAC2716 (trpA)
Enzymes [BR:xac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XAC2716 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Peripla_BP_6 TMP-TENI PcrB DUF561
Motif
Other DBs
NCBI-ProteinID: AAM37561
UniProt: Q8PJ29
Position
complement(3176119..3176925)
Genome map
AA seq 268 aa AA seqDB search
MRRIDSCFAELRANGRKALIPFITAGDPSLEATVPVMHALVRAGADVIELGVPFSDPMAD
GPTIQRSSERALARGAGLAYVLEAVHEFRREDATTPVVLMGYLNPIEIHGTRRFAEAAVA
AGVDGVLLVDLPPEEAGETRTIFTEVGLALIALASPTTSEQRLDMLCSTAQGYLYYVSFA
GVTGASNLLDTHAASDRLRQLRRRAGAPVVAGFGIKDAASAAAMAVDADGVVVGSALVAA
LAEVNDVRSARERAEAFLAPLRQALDQG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtatcgattcctgcttcgccgagctgcgtgccaatgggcgcaaggcactgatc
cctttcatcaccgccggcgacccatcgttggaagccaccgtgccggtgatgcacgcgctc
gtgcgcgccggtgccgatgtgatcgagctgggtgtgccgttctccgacccgatggccgac
ggccccaccatccagcgcagctccgagcgcgcgctggctcgtggcgctggcctggcgtat
gtgctggaagcggtgcacgagttccgccgcgaagatgccaccaccccggtggtgttgatg
ggctacctcaacccgatcgagatccatggcacgcgacgcttcgccgaggccgcggtcgcc
gcgggcgtggatggcgtgctgctggtcgacctgccgccggaggaagccggcgagacgcgc
accatcttcaccgaggtcggcttggcgctgatcgcactggcctcgcccaccaccagcgag
cagcgcctggatatgttgtgcagcaccgcgcagggctatctgtactacgtcagctttgcc
ggcgtcaccggcgcctccaatctgctcgacacccacgccgccagcgatcgcctgcgccag
ctgcgtcggcgtgccggcgcgcccgtggtggccggcttcggcatcaaggatgcggccagc
gccgctgccatggccgtggatgccgacggcgtggtggtgggcagtgccctggtcgctgct
ttggcggaagtgaacgacgtgcgtagcgcccgtgaacgcgccgaagcgttcctggccccc
ttgcgccaggcgctcgaccagggatga

DBGET integrated database retrieval system