KEGG   Xanthomonas citri pv. citri 306: XAC2874Help
Entry
XAC2874           CDS       T00084                                 

Gene name
gpm
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac00010  Glycolysis / Gluconeogenesis
xac00260  Glycine, serine and threonine metabolism
xac00680  Methane metabolism
xac01100  Metabolic pathways
xac01110  Biosynthesis of secondary metabolites
xac01120  Microbial metabolism in diverse environments
xac01130  Biosynthesis of antibiotics
xac01200  Carbon metabolism
xac01230  Biosynthesis of amino acids
Module
xac_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XAC2874 (gpm)
  Energy metabolism
   00680 Methane metabolism
    XAC2874 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XAC2874 (gpm)
Enzymes [BR:xac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     XAC2874 (gpm)
Membrane trafficking [BR:xac04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    XAC2874 (gpm)
Exosome [BR:xac04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   XAC2874 (gpm)
  Exosomal proteins of melanoma cells
   XAC2874 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AAM37719
UniProt: Q8PIM1
Position
complement(3373708..3374457)
Genome map
AA seq 249 aa AA seqDB search
MTRKLVLLRHGQSQWNLDNRFTGWVDVELTDQGRQEAVAAGRLMKDEGLQFDVAHTSVLK
RAIHTLQGALKELDQDWLPVSKSWRLNERHYGGLQGLDKAETAAKHGEEQVKIWRRSYDI
PPPAMDVNDPGHPCHDRRYATLDRNALPGTESLATTLVRVLPYWHDAIAPQLKAGQTVLV
TAHGNSLRALYKYLNDVSNEQILELNIPTGIPLLFELDDSLQVRSFRYLGDPEAAKRAAE
AVANQGKAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcaaactcgtactgctgcgccatggccagagccaatggaatctggacaaccgt
ttcaccggctgggtggatgtggaactcaccgaccagggccgccaggaagctgtggcggcc
ggcaggctgatgaaggacgaagggctgcagttcgatgtcgcccacacctcggtgctcaag
cgcgccatccacacgctgcagggcgcgttgaaggaactcgaccaggactggttgccggtg
tccaagagctggcgcctcaacgagcgccactacggtggcctgcaaggcctggacaaggcc
gaaaccgcggcaaagcacggcgaggagcaggtcaagatctggcgccgttcctacgacatc
ccgccgccggcgatggacgtcaacgacccgggccacccgtgccacgaccgtcgctacgcc
acgctggaccgcaatgcattgccaggcaccgagtcgctggcgaccacgctggtgcgcgtg
ttgccgtattggcacgacgcgattgcgccgcagttgaaggccgggcagaccgtgctggtg
accgcgcacggcaattcgctgcgcgcgctctacaagtacctcaacgatgtctccaatgag
cagatcctggagctcaacatccccaccggcatcccgttgctgttcgagctggacgacagc
ctgcaggtgcgcagcttccgttacctgggcgacccggaggcggccaagcgcgcggccgaa
gcggtggccaatcagggcaaggcgaagtaa

DBGET integrated database retrieval system