KEGG   Xanthomonas citri pv. citri 306: XAC3120Help
Entry
XAC3120           CDS       T00084                                 

Gene name
glk
Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac00010  Glycolysis / Gluconeogenesis
xac00052  Galactose metabolism
xac00500  Starch and sucrose metabolism
xac00520  Amino sugar and nucleotide sugar metabolism
xac00521  Streptomycin biosynthesis
xac01100  Metabolic pathways
xac01110  Biosynthesis of secondary metabolites
xac01120  Microbial metabolism in diverse environments
xac01130  Biosynthesis of antibiotics
xac01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XAC3120 (glk)
   00052 Galactose metabolism
    XAC3120 (glk)
   00500 Starch and sucrose metabolism
    XAC3120 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    XAC3120 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XAC3120 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    XAC3120 (glk)
Enzymes [BR:xac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     XAC3120 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: AAM37965
UniProt: Q8PHX8
Position
3667833..3668867
Genome map
AA seq 344 aa AA seqDB search
MAATSRSAYASASPDVPVAISFIAADVGGTHVRVGHMLQARDAAIELSHYRTYRCAEYAS
LQAILEDFLQQRRGVDAVVIASAGVALDDGSFISNNLPWTISPSRIGAALAVRNVHLVND
FEAVAYAAPQMEQRAVLQLSGPTPRHARANGPILVVGPGTGLGAALWIDAKPRAIVLATE
AGQVALASTHPREYAVLQCLLRDRHYLPLEHVLSGPGLRHLYDAVCELHGATPRHRLPAA
VTHAALHEDDALARECLEIFCGLLGSAVGDMALAYGAAGGIYLAGGFLPTIGQFLAGSAF
AERFLDKGNMRAVLERIPVKLVEHGQLGVLGAANWYLQHHTDLS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtggctgcgacttcgcgttccgcttacgcctctgcctcgcccgatgtccccgttgccatc
agcttcatcgctgccgatgtcggcggcacgcatgtgcgtgtcgggcacatgctgcaggcg
cgcgatgcagccatcgagctttcgcattaccgcacctatcgctgcgccgagtacgccagt
ctccaggccatcctcgaggatttcctgcaacagcggcgcggcgtcgatgcggtggtcatc
gccagtgccggcgtggcgctggacgatggcagcttcatcagcaacaacctgccatggacg
atttcacccagccgcatcggtgctgcactggcagtgcgcaacgtgcacctggtcaacgat
ttcgaggcggtggcctacgcagcgccgcagatggaacaacgcgccgtgctgcagctgagc
gggccgacaccgcgccatgcgcgtgccaacgggccgattctggtggtcggccccgggacc
ggtctgggtgcagcactatggatcgatgccaagccacgcgcgatcgtgctggccaccgaa
gccggccaggtcgcgctggccagcacccatccgcgcgagtacgccgtgctgcaatgcctg
ttacgtgaccggcactatttgccgctcgagcacgtgctctccggcccgggattacggcat
ctctacgatgcggtgtgcgagctgcatggcgcaacgccgcgtcatcgtctgcccgccgcc
gtgacgcacgcagcgctgcacgaagacgatgcgcttgcgcgcgagtgcctggagattttt
tgcggcctgctggggagcgcggtcggcgacatggcgctggcctacggcgctgccgggggc
atctatctggccgggggcttcctgccgacgatcggccagttcctggctggcagcgccttt
gccgagcgcttcctggacaagggaaacatgcgcgctgtgctcgaacgcattccggtcaaa
ttggtcgagcacgggcaactgggcgtgctcggcgcggccaactggtatctgcagcaccac
accgacctgtcgtaa

DBGET integrated database retrieval system