KEGG   Xanthomonas citri pv. citri 306: XAC3438Help
Entry
XAC3438           CDS       T00084                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac00010  Glycolysis / Gluconeogenesis
xac00030  Pentose phosphate pathway
xac00051  Fructose and mannose metabolism
xac00052  Galactose metabolism
xac00680  Methane metabolism
xac01100  Metabolic pathways
xac01110  Biosynthesis of secondary metabolites
xac01120  Microbial metabolism in diverse environments
xac01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XAC3438 (pfkA)
   00030 Pentose phosphate pathway
    XAC3438 (pfkA)
   00051 Fructose and mannose metabolism
    XAC3438 (pfkA)
   00052 Galactose metabolism
    XAC3438 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    XAC3438 (pfkA)
Enzymes [BR:xac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     XAC3438 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     XAC3438 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AAM38281
UniProt: Q8PH22
Position
4048222..4049478
Genome map
AA seq 418 aa AA seqDB search
MTTGNLLYAQSGGVTAVINATAAGVIAEARARKIKVLAARNGILGALREELIDTSKESAA
AIAALAQTPGGAFGSCRYKLKSLEEDSAKYERLLDVLRAHDVRWFLYNGGNDSADTAWKV
SQLAKAYGYPLHCIGVPKTIDNDLAATDTCPGFGSAAKYTVVSVREAALDVAAMADTSTK
VFIYEAMGRHAGWLAAAAGLAGQGPDDAPQIILLPERAYDQAAFLAKVKQVVEKVGWCVV
VASEGIQDAHGKFVADAGGAADSFGHAQLGGVASFLAAQVKQELGYKVHWTLPDYLQRSA
RHLASKTDWEQAQAVGKAAVQYAIKGMNAVIPVIERVSDAPYRWKIVPAPLHKVANHEKK
MPPSFLRKDGFGITERARRYFAPLIKGEAALAYGSDGLPKYVSLKNVAVAKKLPAWEG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaccactggcaacctgctctatgcccaatccggcggcgtcaccgccgtcatcaatgcc
actgccgccggcgtcatcgccgaagcgcgcgcacgcaagatcaaggtactggctgcgcgc
aatggcatcctgggcgccttgcgcgaggagttgatcgatacctccaaggaatccgctgca
gccattgccgcattggcgcagacccccggcggcgctttcggctcgtgccgctacaagctc
aaatcgctggaggaagacagcgccaagtacgaacgtctgctcgacgtgctgcgcgcgcac
gacgtgcgctggttcctctacaacggcggcaacgactcggccgacaccgcgtggaaggtc
tcgcaactcgcaaaggcctatggttacccgctgcactgcatcggcgtgccaaagaccatc
gacaacgatctggcggcgaccgacacctgccctggcttcggctcggcggccaagtacacc
gtcgtctcggtacgcgaggccgcactggatgtcgccgccatggccgacacctccaccaag
gtcttcatctatgaggcgatgggccgccatgccggttggctggccgcagcggcaggcctg
gccgggcaaggcccggacgacgccccgcagatcatcctgctacccgaacgcgcctacgac
caggctgcattcctggccaaggtgaaacaggtggtggagaaggtcggctggtgcgtggtg
gtggccagcgagggcatccaggacgcacacggcaagttcgtcgccgatgccggtggcgcg
gccgactcgttcggccatgcacagctcggcggcgtggcctcgttcctggccgcacaggtc
aagcaggaactcggctacaaggtgcactggacgttgccggattacctgcagcgctccgca
cgccacctcgcatccaagacggactgggaacaggcgcaagcggtcggcaaggccgccgtg
caatacgcgatcaaaggcatgaacgcggtgatcccggtgatcgaacgcgtcagcgacgca
ccctaccgctggaagatcgtgcccgcccccctgcacaaggtggccaatcacgaaaagaag
atgccgcccagcttcctgcgcaaggacggcttcggcatcaccgaacgcgcccgccgctac
ttcgccccgttgatcaagggcgaagccgcgctggcctacggcagcgatggcttgccgaag
tatgtgagtttgaagaatgtcgcggtggcgaagaaattgccagcttgggaggggtga

DBGET integrated database retrieval system