KEGG   Xanthomonas citri pv. citri 306: XAC4121
Entry
XAC4121           CDS       T00084                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
xac  Xanthomonas citri pv. citri 306
Brite
KEGG Orthology (KO) [BR:xac00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xac02044]
    XAC4121
Secretion system [BR:xac02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XAC4121
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: AAM38956
UniProt: Q8PF64
Position
complement(4838787..4840121)
AA seq 444 aa
MQNNKVVWSEGLFLRPQHLQQQERYLERYVDLRAARLRPHAWGVSELEWESDLLAVGKLG
LRRARGVFADGTPFAMPGDDPLPVALEVEPNCRDQIVYLTVPLRVPAQPELGRPESPADQ
LFRYRVRETESNDASGSTSEAVLMEVGGLSTRLLPHSQPLEGLDRIAVARIIEMRADRQV
VLDPHFIPSAMVCQAAPRLTTFLTELLGLLHQRGEALASRVTLTDRGGAADIADFLLLQL
VNRWQPQMAHWAAAPLAHPEELFRALVALAGELSTFTAAGKRPPAWPAYRHQSQQDSFEP
VIGALRSSLSAVLEQTATPLPIQARKFGVWVAMVPDPGLLDSAAFVLAAKADMPSEELRR
QLPAHAKIGPVEQIRDLVNLQLPGIVATPMPVAPRQIPYHAGYLYFEFDKSAALWRTLKT
SGGIAFHFGSEFAGLDLQLWAIRS
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgcagaacaacaaggtcgtgtggagcgaagggctgttcctgcgcccgcagcatctgcag
cagcaagagcgctacctggagcgctacgtcgatctgcgtgccgcgcgattgcggccgcat
gcctggggcgtgagcgagctggaatgggagagcgacctgctggcggtgggcaagctgggc
ctgcggcgcgcgcgtggcgtgttcgccgatggcacgcccttcgcgatgccgggcgacgac
ccgctgccggttgcgctggaggtcgagcccaactgccgcgaccagatcgtctatctcacc
gtaccgctgcgggtgccggcgcagcccgaactcgggcgcccggaatcgccggccgatcag
ctgtttcgctaccgcgtgcgcgagaccgaaagcaacgacgcctccggcagcaccagcgaa
gcggtgttgatggaagtcggcgggttgagcacgcggttgctgccgcactcgcaaccgttg
gaggggctggaccgcatcgcggtggcgcgcatcatcgagatgcgcgccgaccgtcaggtg
gtgctggacccgcatttcattcccagcgcgatggtatgccaggcggcgccgcgcttgacc
acctttctgaccgagttgctcggtctgttgcatcagcgcggcgaagcgctggcatcgcgc
gtgacgctgaccgatcgcggcggtgcggccgatatcgcagactttctgctgctgcagctg
gtcaaccgttggcagccgcagatggcgcactgggcggccgcgccattggcgcatccggaa
gagttgtttcgcgccttggtggcgctggccggtgaactgagcacgttcaccgctgccggc
aagcgcccgcctgcatggcctgcctatcggcaccaatcgcagcaggacagcttcgagccg
gtgatcggcgccttgcgcagcagtttgagcgcagtgctcgaacagaccgccacgccgctc
ccgatccaggcgcgcaagttcggcgtgtgggtggcgatggtgccggacccgggcctgctc
gacagcgcggcgttcgtgctcgcggccaaggccgacatgcccagcgaagagttgcgccgg
caattgcccgcgcacgccaagatcgggccggtggagcagattcgcgatctggtcaatctg
cagttgcccggcatcgtggccacgcccatgccggtggcgccgcgacagattccgtatcac
gccggctatctgtatttcgaattcgacaagagcgcagcgttgtggcgaacgctgaagacc
tccggcggtatcgcattccacttcggcagcgaattcgccgggttggacctgcaattgtgg
gcgatccggagctga

DBGET integrated database retrieval system