KEGG   Xanthomonas citri pv. citri 306: XACb0037
Entry
XACb0037          CDS       T00084                                 

Gene name
virB11
Definition
(GenBank) VirB11 protein
  KO
K03196  type IV secretion system protein VirB11 [EC:7.4.2.8]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xac00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XACb0037 (virB11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xac02044]
    XACb0037 (virB11)
Enzymes [BR:xac01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     XACb0037 (virB11)
Secretion system [BR:xac02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   XACb0037 (virB11)
SSDB
Motif
Pfam: T2SSE
Other DBs
NCBI-ProteinID: AAM39283
UniProt: Q8PRJ5
Position
pXAC64:complement(33968..34990)
AA seq 340 aa
MSQIASFRTKLSLLADYLDDKQVTEIQVNKPGELWLRKKDAYYAEQIEVPGLTYQLLSSL
AEVTASFKSLEVDRDSPILSAEIPVNLDDGVPDFERGTYRTEMILPPVVPEGTIAMTIRK
QSLVRMSLPKYREQGAFRFVNSDVLDEPYSDARLLDLYRANEWDEFLRGAVLAHKNIVIS
AGTYCGKTTCLNALVQEIPAHERIVTIEDSREIEPAQPNCVRLSYARHQASGQAAVTPTT
LLRSCMRLTPDRVIMGEIRGPEAVEFLNMLNTGHKGSLTTIHTDSPAEMYDRFGELMDGH
TSMTREQVIARVKRRIDVVVQWKYTERNGRYISEIIYAGA
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgtcgcagattgcctccttccgtaccaagctctccttgctggccgactatctcgatgac
aagcaggtcaccgagattcaggtcaacaagccgggagagctttggctgcgaaagaaagac
gcgtactacgccgagcaaatcgaagtgccggggctgacatatcagttgctctcgtcgctg
gccgaagtcacggcgtctttcaagagtctggaagttgaccgggatagtccgattctctcg
gccgaaatcccggtcaacctcgatgacggtgttccagacttcgagcgcggaacgtatcgc
acggaaatgattcttccgcctgtcgtaccggagggcaccatcgcgatgacgattcgcaaa
cagtcgctggttcggatgagcctgccgaagtacagggagcagggcgcttttcggttcgtg
aatagcgacgtgctcgatgagccgtattccgatgctcgcttgctggacctgtatcgcgcg
aatgagtgggacgaatttctgcgcggcgcagtgttggcccacaagaacattgtcatatcg
gccggaacgtactgcggcaagaccacgtgcctcaatgcgttggtgcaggaaatccctgca
cacgagcggatcgtcacgattgaagactcgcgggagatcgaacctgcgcaaccaaactgc
gtgcgactttcttacgcgcgccatcaggcgtcggggcaagctgccgtaacgcccacaacg
ttgcttcgctcgtgcatgcgactcacgcccgaccgggtcatcatgggcgagattcgcggc
ccggaagcggttgagttcttgaacatgctcaacacgggccacaaggggtcgctcacgacg
attcacaccgattcgccggccgaaatgtacgaccgttttggcgagttgatggacggtcac
acatccatgacgcgcgagcaggtcatcgcgcgcgtcaagcggcgaatcgatgttgttgtg
cagtggaaatacaccgagcgcaacggccgctacatctcggagatcatctatgcaggtgcg
taa

DBGET integrated database retrieval system