KEGG   Xanthomonas citri pv. citri 306: XACb0040Help
Entry
XACb0040          CDS       T00084                                 

Gene name
virB8
Definition
(GenBank) VirB8 protein
  KO
K03203  type IV secretion system protein VirB8
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xac00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XACb0040 (virB8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xac02044]
    XACb0040 (virB8)
Secretion system [BR:xac02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   XACb0040 (virB8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB8
Motif
Other DBs
NCBI-ProteinID: AAM39286
UniProt: Q8PRJ2
Position
pXAC64:complement(37030..37704)
Genome map
AA seq 224 aa AA seqDB search
MKFGKKTFLGDKETQSAQLGGSNKLKQERNRAYLLIGLLLFVVGGMASAVTVLANIHTVI
PVVSVIDANGHVVKQQVVNKEAITGQESFVQSQVYDFIMYCNTFDPDWRQHFADLCRLHS
TQTVAGQYDAETSPDNPNNPYYQLGQGGRRYPKITGITSLGKDAYQVSFQSITEKAGSPP
KTDYYTALVRYTFTFKPLALGDRWENALGYATTAYRKDQELSRQ
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcggcaagaaaacttttttgggcgacaaagagacgcagtcggcccaattgggc
ggctcgaacaagctcaaacaggaacgtaaccgcgcgtatctgctcatcgggttgctgctg
ttcgtcgtcggcggcatggcgagtgcggtcacggtgctcgccaacattcacacggtcatt
ccagtggtgtcggtcattgacgcgaacgggcacgtggtgaaacagcaggtggtcaacaag
gaagcgatcacggggcaggaaagcttcgtccagagccaggtgtacgacttcatcatgtac
tgcaacacgttcgacccggactggcggcagcactttgccgacctctgccggctgcactcg
acacaaacggtagcaggccagtacgacgcggaaaccagccccgataacccgaacaatccg
tattaccagctcgggcagggcggccggcgttacccgaagatcacgggcattacgtcgcta
ggcaaggacgcctatcaggtgtcgttccagtcgattacagagaaggcaggcagtccgccg
aagacggactactacaccgcgctcgttcgctacaccttcaccttcaagccgctcgccctg
ggcgaccggtgggaaaacgcattgggctacgcgacgacggcataccgcaaagatcaagag
ttgagccgccagtaa

DBGET integrated database retrieval system