KEGG   Xanthomonas albilineans: XALC_0658Help
Entry
XALC_0658         CDS       T01160                                 

Definition
(GenBank) putative phospholipase c precursor protein
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
xal  Xanthomonas albilineans
Pathway
xal00562  Inositol phosphate metabolism
xal00564  Glycerophospholipid metabolism
xal00565  Ether lipid metabolism
xal01100  Metabolic pathways
xal01110  Biosynthesis of secondary metabolites
xal02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:xal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    XALC_0658
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    XALC_0658
   00565 Ether lipid metabolism
    XALC_0658
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    XALC_0658
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:xal02042]
    XALC_0658
Enzymes [BR:xal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     XALC_0658
Bacterial toxins [BR:xal02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   XALC_0658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756
Motif
Other DBs
NCBI-ProteinID: CBA15176
UniProt: D2UCE2
Position
709660..711747
Genome map
AA seq 695 aa AA seqDB search
MVEYSRRRFLARASLALGAGAAMPLLPGAIRSALAVPPARVTGTLQDVQHVVILMQENRS
FDHYFGCLRGVRGYGDPRPLRLPNGRPVWYQPEPGAGERHVLPFRLDSQTTSAQWMKDLN
HDWKGAHDTWKHHDAWIAQKSAMSMGHFQREDLPFYYALADAFTICDGYHASLFGPTNPN
RMYMFTGTSGLSVGNDGEQAVNNRDDGNWTADMARDNPRFPGYTWTTYAERLQQAGIRWQ
VYQEFDNYGDNSHAYFARFRNLDLASPLYRRGRAWVPGSSADNAKASRGEHLLAAFARDV
RAGTLPQVSWVVAPYLLSEHPEATPAYGQSLSARLLDILAGSPEVWSKTVFLINYDENDG
FFDHVPPALPAILPELGASNVDLHGEDYHGVPVGLGPRVPMLVVSPWSRGGWVNSQVFDH
TSVIRFLERRFGVMEPNINPWRRAVAGDLTSTLDFAGHDAAPVVLPHTGDFIARIDATAT
LPPPQRPLQQALPVQEPGQRPARALPYDVDVRLQVQAQARVLRMRNRGAAGVALNVYADD
GVAGPWFYTLAAGSELQDARAWRGDVADAGYALRVHGPNGFLREFHGDGLADAGLHAEIE
YDVAAQCLLLELGNAGAQSATLRVRDGYRDGAERTHVLAPGARRVLRFPLQAQHHWYDLL
VTSEAMPPWRRRLAGHIETGHPSMSDPAIGRAAVV
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgaatatagccgtcgtcgtttccttgcccgtgcgtccctggccctgggggcagga
gcggccatgccgctgttgccgggagccatccgcagtgcgctggcggtgccgccggcgcgg
gtcaccggcacgttgcaggacgtgcagcatgtggtgatcctgatgcaggagaaccgctcc
ttcgaccattacttcggctgtctgcgcggggtgcgtggttatggtgatccacggccgctg
cgcttgcccaatggccggccggtctggtaccagcccgagccgggtgctggagagcgccat
gtgctgccgtttcggctcgacagccagacgaccagcgcgcagtggatgaaggacctcaac
cacgattggaagggcgcgcacgacacctggaaacatcacgatgcctggatcgcgcagaag
agcgcgatgagcatgggccatttccagcgcgaggacttgccgttctactacgcgctggcc
gacgccttcactatttgcgatggctaccacgcctctttgtttggtccgaccaatcccaac
cgcatgtacatgttcaccggcaccagcggcctgagcgtcggcaacgatggcgaacaggcg
gtgaacaatcgtgatgacggcaactggaccgcggatatggcgcgggataatccgcgcttt
cccggctacacctggaccacttacgccgaacgcttgcagcaggccggcatccgttggcag
gtgtatcaggagttcgacaactacggcgacaacagtcacgcgtatttcgcccgcttccgc
aacctggatctagcttcgccgttgtaccgtcgcggccgtgcctgggtgccgggttccagc
gccgacaacgccaaggcgtcgcgtggcgaacatctgctcgccgcgttcgcgcgcgacgtg
cgcgctggtaccttgccccaggtttcctgggtcgtcgcgccttacttgctcagcgaacat
cccgaggccacgccggcttacgggcaatcgttgagcgcgcgcctgttggacatcctggcc
ggatcgcccgaggtctggtccaagacggtatttctgattaattacgacgaaaacgatggt
ttcttcgaccacgtgcccccggcattgccggcgatccttccggagctgggggccagcaac
gtggacctgcacggcgaggactatcacggggtcccggtcggactggggccgcgcgtgccg
atgttggtggtgtcgccgtggagccgcggtggctgggtgaattcgcaagtgttcgaccac
acctcggtgatccgcttcctggagcgtcgtttcggtgtcatggaacccaacatcaatccc
tggcgtcgcgctgtggctggcgatctgacctcgacgttggacttcgccggtcacgatgcg
gcgccggtggtgttgccgcacacgggcgacttcatcgcccgcatcgatgccaccgcgacg
ctgccgccgccgcagcgtccgttgcagcaggcgctgccggtgcaagaacccggccagcgc
ccggcgcgtgcgctgccctacgatgtcgatgtgcgtctgcaggtgcaagcgcaggcgcgg
gtgttgcgcatgcgcaaccgtggcgccgccggggtggcgctcaatgtctatgccgatgac
ggcgtcgccggcccctggttctacacgctggccgccggtagcgagctgcaggacgcgcgc
gcgtggcgcggcgatgtcgccgatgccgggtatgcgctgcgcgtgcatgggccgaatggc
tttctgcgcgagttccatggcgacggcctggccgacgccggtttgcatgccgagattgaa
tacgacgttgcggcgcaatgcctgctgctggagttgggcaatgcgggcgcgcagtccgct
acgctgcgggttcgcgatggctatcgggacggtgcggagcggacgcacgtgctggccccg
ggcgcgcgccgcgtgctgcgtttcccgctgcaggcgcagcaccattggtacgatctgctg
gtcaccagcgaggccatgccgccgtggcggcgacgcttggccggacatatcgaaaccgga
catccgagcatgagcgatccggcgatcgggcgcgcggccgtcgtctga

DBGET integrated database retrieval system