KEGG   Xanthomonas albilineans: XALC_1124Help
Entry
XALC_1124         CDS       T01160                                 

Definition
(GenBank) hypothetical glutathione peroxidase protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
xal  Xanthomonas albilineans
Pathway
xal00480  Glutathione metabolism
xal00590  Arachidonic acid metabolism
xal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    XALC_1124
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    XALC_1124
Enzymes [BR:xal01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     XALC_1124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: CBA15639
UniProt: D2UDL6
Position
1319616..1320107
Genome map
AA seq 163 aa AA seqDB search
MEMQTTAYAFTATTLDGHVQPLVDYAGNVLLIVNVASKCGFTPQYAGLQALWERYRDRGL
VVLGFPCDQFGHQEPGNADEIRQFCSLSYGVDFPMFAKVQVNGENAHPLWRWLKQQKSGA
FGIAAIKWNFSKFLLDRKGQVLARYAPTTKPEALAVQIERALG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggagatgcagaccacggcttatgcctttactgcgacgaccctggatggccatgttcag
ccgctggtcgattacgccggcaatgtgctgctgatcgtcaatgttgcatccaaatgcggc
ttcactccgcaatatgcaggtctgcaggcgctgtgggagcggtaccgcgatcgtggcctg
gtggtactcggtttcccgtgcgatcagttcggtcatcaggaaccgggcaatgccgatgag
atccgccagttctgttcgttgagctacggtgtcgatttcccgatgttcgccaaggtgcag
gtcaatggcgagaatgcgcatccgttgtggcgctggctcaagcagcaaaagtcgggtgcg
ttcggaatcgcggcgatcaaatggaatttcagcaagtttctgcttgatcgcaaggggcag
gtgctggcgcgttatgcgcccaccaccaagccggaagcgctggccgtacagatcgagcgc
gcgttgggctga

DBGET integrated database retrieval system