KEGG   Xanthomonas albilineans: XALC_2488Help
Entry
XALC_2488         CDS       T01160                                 

Gene name
metS
Definition
(GenBank) probable methionyl-trna synthetase protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
xal  Xanthomonas albilineans
Pathway
xal00450  Selenocompound metabolism
xal00970  Aminoacyl-tRNA biosynthesis
xal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    XALC_2488 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    XALC_2488 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xal01007]
    XALC_2488 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xal03016]
    XALC_2488 (metS)
Enzymes [BR:xal01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     XALC_2488 (metS)
Amino acid related enzymes [BR:xal01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   XALC_2488 (metS)
Transfer RNA biogenesis [BR:xal03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    XALC_2488 (metS)
 Prokaryotic type
   Other AARSs
    XALC_2488 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: CBA16967
UniProt: D2U9L5
Position
2957339..2959399
Genome map
AA seq 686 aa AA seqDB search
MTRTALVTTALPYANGPLHLGHLVGYIQADIWVRARRLHGDRAWFVCADDTHGTPIMLAA
EKAGVTAEDFIASIQASHERDFAAFGVAFDHYDSTNSAANRALTEAFYARLDAGGHIARR
RVAQFYDPAKGMFLPDRYIKGICPNCGSADQYGDNCEVCGATYAPTELKEPKSVISGTTP
ELRDSEHFFFEVGRFDRFLRDWLAGDVALPGVKAKLMEWLDSEGGLRAWDISRDAPYFGF
QIPGQPGKYFYVWLDAPIGYLSSFQTLCARLGESFEAHLAAGSSTELHHFIGKDIVNFHG
LFWPAVLHGTGHRAPTRLHVNGYLTVDGAKMSKSRGTFVMARTYLDVGLEPEALRYYFAA
KSSGGVDDLDLNLSDFIARVNADLVGKFVNLASRCAGFIDKRFGGTLAETLPDPAQYAHF
VAALSPIREAYARNDPASAIRQTMALADEANKYIDEHKPWVLAKQDGAEASLQAVCTQGL
NLFRVLAAALKPVLPHTCAEAEAFLVAPLAAWDALQAPLLAHAIKPYTPLFTRIDPHLID
AMTDASKDTFAPAAGTATPAAKPAAPIAPNAPAASPALVGMDDFAKLDLRIGKVLACECV
EGSDKLLRFELDAGALGKRQIFSGIRASYAEPDKLVGRSVVFIANLAPRKMRFGISEGMI
LSAGFDGGALALLDADSGAQPGMPVR
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcaccgctctcgtcacaaccgctctaccttatgccaacggaccgttgcatctg
gggcatctcgtcggctacatccaggccgacatctgggtacgcgcacggcggctgcatggc
gaccgcgcctggttcgtgtgtgccgacgacacccacggcacgccgatcatgctcgcggcg
gaaaaagccggcgtcactgcggaagatttcatcgccagcatccaggccagccacgagcgc
gatttcgccgcgttcggcgtcgccttcgaccattacgactcgaccaactcggcggccaac
cgcgcactgaccgaagcgttctacgcccgcctcgacgccggcggccatatcgcgcgccgc
cgggtcgcgcagttctacgacccagccaagggcatgttcctgcccgaccgctacatcaag
ggcatctgcccgaactgcggcagcgccgaccaatacggcgacaactgcgaggtctgcggc
gccacctatgcgccgaccgaactgaaggagcccaagtcggtgatctccgggaccacgccg
gagctgcgcgattcggagcactttttcttcgaagtcggccgcttcgaccgcttcctgcgc
gactggctggccggcgacgtcgccctgcccggcgtcaaggccaagctgatggaatggctg
gacagcgaaggcggcctgcgcgcctgggacatctcgcgcgatgcgccgtacttcggtttc
cagatccccgggcaaccggggaaatatttctatgtgtggctggacgcgccgatcggctac
ttgagcagttttcagaccctgtgcgcacgcctgggcgagtcgttcgaagcgcacctagcc
gctggcagcagcaccgaattgcaccatttcatcggcaaggacatcgtcaacttccatggc
ctgttctggccagcggtactgcatggcaccggccatcgcgcaccaacccggttgcacgtc
aacggctacctgaccgtcgatggcgccaaaatgtccaagtcgcgcggcaccttcgtcatg
gcccgcacctacctcgacgtaggcctggagccggaagcgctgcgctactacttcgccgcc
aagtcctccggcggcgtcgacgatctcgacctgaacctcagcgacttcatcgcgcgggtc
aatgcagatctggtcggcaagttcgtcaacctggccagccgctgtgccggcttcatcgac
aagcgcttcggcggcacgctcgccgagacgctgcccgatccagcgcaatacgcccacttc
gtcgccgcattgtccccaatccgcgaggcgtatgcgcgcaacgacccggccagcgcgatc
cgccagaccatggcccttgcagacgaagccaacaagtacatcgacgaacacaaaccctgg
gtgctggccaagcaggacggtgccgaggcctcgctgcaagcggtatgcacccagggtttg
aacctgttccgggtgctggccgccgcgctcaagccggtgctgccgcacacgtgcgccgaa
gccgaggcgttcctggtcgcgccgctggctgcttgggacgcactgcaggcgccgttgctg
gcgcacgcgatcaagccctacacaccactgttcacccgaatcgacccccacctgatcgac
gccatgaccgacgcctccaaggacaccttcgcccccgccgctggcacggcgacacccgcc
gccaagccagccgcgcctatcgcgccgaatgccccggccgccagtcccgcgctcgtcggc
atggacgatttcgccaagctcgacctgcgcatcggcaaagtgctggcctgcgaatgcgtc
gagggctcggacaagctgctgcgcttcgaactggatgccggcgcgctgggcaagcggcag
attttctccggcatccgcgccagctatgccgaaccggacaaactggttggccgcagcgtg
gtcttcatcgccaacctggcaccgcgcaagatgcgcttcggcatcagcgaaggcatgatc
ctgtcggctggcttcgatggcggtgcgctggccctgctcgacgccgacagcggtgcgcag
ccgggcatgccggtgcgctga

DBGET integrated database retrieval system