KEGG   Xanthomonas albilineans: XALC_2525Help
Entry
XALC_2525         CDS       T01160                                 

Gene name
atoB
Definition
(GenBank) probable acetyl-coa c-acetyltransferase protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xal  Xanthomonas albilineans
Pathway
xal00071  Fatty acid degradation
xal00072  Synthesis and degradation of ketone bodies
xal00280  Valine, leucine and isoleucine degradation
xal00310  Lysine degradation
xal00362  Benzoate degradation
xal00380  Tryptophan metabolism
xal00620  Pyruvate metabolism
xal00630  Glyoxylate and dicarboxylate metabolism
xal00640  Propanoate metabolism
xal00650  Butanoate metabolism
xal00900  Terpenoid backbone biosynthesis
xal01100  Metabolic pathways
xal01110  Biosynthesis of secondary metabolites
xal01120  Microbial metabolism in diverse environments
xal01130  Biosynthesis of antibiotics
xal01200  Carbon metabolism
xal01212  Fatty acid metabolism
xal02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XALC_2525 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    XALC_2525 (atoB)
   00640 Propanoate metabolism
    XALC_2525 (atoB)
   00650 Butanoate metabolism
    XALC_2525 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XALC_2525 (atoB)
   00072 Synthesis and degradation of ketone bodies
    XALC_2525 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XALC_2525 (atoB)
   00310 Lysine degradation
    XALC_2525 (atoB)
   00380 Tryptophan metabolism
    XALC_2525 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XALC_2525 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XALC_2525 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    XALC_2525 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xal04147]
    XALC_2525 (atoB)
Enzymes [BR:xal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     XALC_2525 (atoB)
Exosome [BR:xal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XALC_2525 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C DUF3323 ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CBA17004
UniProt: D2U9Q2
Position
2998909..3000084
Genome map
AA seq 391 aa AA seqDB search
MTEIVIAAAKRTAIGAFLGQFNGVPTPTLGAAAIRAALEQSGIAAVDVSEVIMGCVLPAN
LGQAPARQAARAAGLPDATGATTINKVCGSGMKAVMLGHDLIKAGSASIVVAGGMESMSN
APHLLPNSRIGNRYGNFQAVDHMAWDGLTNPDDGQAMGVFGEATAEKFGFTRQDQDAFAI
ASVTRAQAAQRGGAFDAEIVPMRIATRKGEVQVASDEQPDKSDIAKIPTLKPAFKKDGTV
TAASSSSISDGAAALVLLSSDDAARRGITPLARIAGHATFSQAPEWFTTAPVGAIRKLLD
QVGWSLDQVDLFEINEAFAVVAMVPIKELGLDHAKVNVNGGACALGHPIGASGARLLVTL
LNALRNRGRRRGIATLCIGGGEATAVAIELI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagatcgtcatcgccgcggccaagcgcactgccatcggcgccttccttggccag
ttcaatggcgtccccacgccaacgctcggcgccgcggccatccgcgccgcgttggagcaa
tccggcatcgccgctgtcgacgtttccgaagtcatcatgggctgcgtgcttccggccaac
ctcggccaagcgcccgcgcggcaagccgcgcgcgcagcaggcctgcccgacgccaccggc
gcgaccaccatcaacaaagtctgcgggtcgggcatgaaggcggtgatgctcggccacgac
ctgatcaaggccggctcggccagcatcgtcgtcgccggcggaatggaatcgatgagtaac
gcgccgcacctgctgcccaattcgcgcatcggcaaccgttacggcaactttcaagcagtc
gatcacatggcctgggacggcctgaccaatcccgacgacggccaagccatgggcgtgttc
ggcgaagcaacggcagagaagttcggtttcacccgccaggatcaggacgcgttcgcgatc
gcatcggtcacccgtgcacaggccgcgcagcgcggcggcgcgttcgatgccgagatcgtt
ccgatgcgcatcgccacccgcaagggagaggtgcaggtcgccagcgacgaacagccggac
aagtccgacatcgccaaaatcccgacattgaagccggcgttcaagaaggatggcacggtg
accgccgccagttcttccagcatctccgacggcgctgcagcactggtgctactaagcagc
gacgatgccgcgcggcgcggtatcacgccgctggcacgtatcgccggccacgcgaccttc
tcgcaggcaccagaatggttcacaaccgcaccggtcggcgcgatccgcaagctgctcgac
caagtcggctggagcctggaccaggtcgatctattcgaaatcaacgaggccttcgccgtg
gtggcgatggtgccgatcaaggaactgggccttgaccatgccaaggtcaacgtcaacggt
ggggcctgcgcgcttggccaccccatcggcgcgtccggcgcacggttattggtgacattg
ctaaacgcgttgcgcaaccgcggccgccgccgcggcatcgccaccctatgcatcggcggg
ggcgaggcaaccgcagtcgccatcgaattgatttga

DBGET integrated database retrieval system