KEGG   Xanthomonas albilineans: XALC_0797Help
Entry
XALC_0797         CDS       T01160                                 

Gene name
gmk
Definition
(GenBank) probable guanylate kinase (gmp kinase) protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
xal  Xanthomonas albilineans
Pathway
xal00230  Purine metabolism
xal01100  Metabolic pathways
Module
xal_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    XALC_0797 (gmk)
Enzymes [BR:xal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     XALC_0797 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin RsgA_GTPase AAA_16 AAA_29
Motif
Other DBs
NCBI-ProteinID: CBA15315
UniProt: D2UCI8
Position
903945..904571
Genome map
AA seq 208 aa AA seqDB search
MRGTLYIVAAPSGAGKSSIVNATLARDPQIALSISFTSRAPRPGERHAEHYHFVAATEFQ
RMIEAGDFFEYASVHGDWKGTARQSVEPQLAAGRDVLLEIDWQGARQVRAKVPDAVSVFI
LPPSRQALEQRMRKRGQDSEAVIAQRLAAAREEMSHYADFDYVIVNEHFDTAVDEMCAIF
VASRLRRLPQQQRHAGLIATLLQESPTG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggcaccctctacatcgtcgcggccccttccggtgccggcaagagcagcattgtc
aacgcgaccctggcgcgcgacccgcagatcgcgttgtcgatctcgttcacctcgcgcgcg
ccgcgcccgggcgaacgtcatgccgagcattatcacttcgtcgctgccacggagttccag
cgcatgatcgaggccggcgatttcttcgaatatgccagcgtgcatggcgactggaagggc
accgcgcggcaatcggtggagccgcagttggctgccggtcgcgatgtgctgctggagatc
gactggcaaggcgcgcgtcaggtgcgcgccaaggtgcccgacgcggtcagcgtgttcatt
ctgccgccgtcgcggcaggcgctggagcagcgcatgcgcaagcgcggtcaggacagcgag
gcggtcatcgcgcagcggctggccgccgcacgcgaggagatgtcgcactacgccgatttc
gactacgtcatcgtcaacgagcatttcgatacggcggtggacgagatgtgcgcgatcttc
gtcgccagccgcctgcgccgcctgccgcaacagcagcgccatgccgggctgatcgcgacc
ctcctgcaggaatcgccaactggctga

DBGET integrated database retrieval system