KEGG   Xanthomonas albilineans: XALC_1467Help
Entry
XALC_1467         CDS       T01160                                 

Definition
(GenBank) putative cytochrome c precursor protein
  KO
K08738  cytochrome c
Organism
xal  Xanthomonas albilineans
Pathway
xal02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xal00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XALC_1467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 RGCC
Motif
Other DBs
NCBI-ProteinID: CBA15974
UniProt: D2UDD6
Position
complement(1692717..1693115)
Genome map
AA seq 132 aa AA seqDB search
MKPVNTFPLWRTLIVSLLPLSLALVPAAHAAGDLPGKGVFASECAECHSATAGKNKKGPS
LFGVAGRRAGSVPDFNYSDAMKQSQWTWSDEKLHSYLSQPASKAMPGTKMKYDGLDDDKQ
LQELITYLHSLH
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccgtcaacaccttcccgctgtggcgcaccctgatcgtcagtctgttgccgctg
agccttgcccttgtacccgccgcacatgccgccggcgacctgcccggtaaaggcgtgttc
gccagcgagtgcgccgaatgccacagcgccacggcaggcaagaacaagaaaggccccagc
ctgttcggagtcgccggacgccgtgccggcagcgtgccggacttcaactactcagacgcc
atgaagcagagccagtggacctggagcgacgagaagctgcacagctacttgtcacagccg
gcgtccaaggcaatgcccgggaccaagatgaagtacgacggactcgacgacgacaaacaa
ttgcaagagttgatcacctatctccacagcctgcattga

DBGET integrated database retrieval system