KEGG   Xanthomonas albilineans: XALC_2032Help
Entry
XALC_2032         CDS       T01160                                 

Gene name
dxr
Definition
(GenBank) probable 1-deoxy-d-xylulose 5-phosphate reductoisomerase protein
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
xal  Xanthomonas albilineans
Pathway
xal00900  Terpenoid backbone biosynthesis
xal01100  Metabolic pathways
xal01110  Biosynthesis of secondary metabolites
xal01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XALC_2032 (dxr)
Enzymes [BR:xal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     XALC_2032 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: CBA16516
UniProt: D2U8W1
Position
2392130..2393317
Genome map
AA seq 395 aa AA seqDB search
MIEAIRTIAVLGATGSIGASALDVIARNPERLRANVLAAGRDVEGLLALCAAHRPAHAVI
ADPALYPALRDGLAAAGLQTAAHTGTAALDQLVASDACDSVLAAIVGAAGLASTLAAARA
GKRLLLANKEALVLAGELVTAAASAAGAEIIPIDSEHNAIFQCLRSRQTGAEVRRVLLTA
SGGPFRGWDRARLQAVTPAQAVAHPKWSMGPKISVDSATLMNKGLEVIEAHHLFALAPSR
IEVLVHPQSLVHSLVEFIDGSTLAQMGLPDMRTSLAVGLGWPERIASGVGGLDLLAHGHL
DFEAPDMDAFPCLRLAWHAMQAGGSAPAILNAANEVAVSAFLQGRIGFLSIPALVDNALT
ELPAVAADSLDALLAADAQSRKITELAIAHHPSHA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaggcgatccgcaccatcgctgtactcggcgccaccggctcgatcggggcctct
gccctggacgtgatcgcacgcaacccggagcgcctgcgcgccaatgtgctggccgctggc
cgcgacgtggaagggctgttggcgctgtgcgccgcgcaccgtccggcgcatgcggtcatc
gccgaccctgccctgtaccccgcgctacgcgacggcctggcggcggctggtttgcagacc
gccgcgcacaccggcactgcggcactggatcaattggtcgccagcgacgcctgcgacagc
gtgctcgccgccatcgtcggcgccgccggcctggcctcgaccctggccgccgcccgcgcc
ggcaagcgcctgctactggccaacaaggaagccctggtgctggccggagaactggtcacc
gccgcagcgagcgcagccggtgccgagatcatcccgatcgacagcgaacacaacgccatc
ttccagtgcctacgctcgcgccagaccggcgccgaagtgcgacgggtgctgctgaccgct
tccggcggcccattccgtggctgggaccgcgcccgcctgcaggcggtgacgccggcacaa
gcggtcgcgcacccgaagtggtcgatggggccgaagatctcggtcgattcggccacactg
atgaacaaaggcctggaggtgatcgaggcgcaccacctgttcgcgctggcgccttcgcgc
atcgaggtgctggtgcatccgcagagcctggtccactcgctggtcgaattcatcgacggc
tccaccttggcgcagatgggcctgccggacatgcgtaccagcctcgccgtgggcctgggc
tggccggaacggatcgcctccggggtcggcggactggacctgctggcgcatggccacctg
gacttcgaggcgccggacatggatgccttcccctgcctgcgcctggcctggcatgcgatg
caggccggcggcagcgcaccagcgatcctgaatgcggccaacgaagtggcggtttcagcg
tttcttcagggccgtatcggtttcctatcgattcctgcgctggtcgataacgccctgacc
gagctgcctgcggtcgcggccgattccctggacgcgttactggcagcagacgcgcaatcg
cgcaagatcaccgaactcgccattgcccaccatccctcccatgcttga

DBGET integrated database retrieval system