KEGG   Xanthomonas albilineans: XALC_2649Help
Entry
XALC_2649         CDS       T01160                                 

Gene name
glgB
Definition
(GenBank) probable 1,4-alpha-glucan branching enzyme protein
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xal  Xanthomonas albilineans
Pathway
xal00500  Starch and sucrose metabolism
xal01100  Metabolic pathways
xal01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XALC_2649 (glgB)
Enzymes [BR:xal01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     XALC_2649 (glgB)
Exosome [BR:xal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XALC_2649 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM DUF3331 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: CBA17126
UniProt: D2UFG5
Position
complement(3133159..3135345)
Genome map
AA seq 728 aa AA seqDB search
MSDAVHVWDEATQHAFATAQHRDPFAVLGAHCLGDAHVLRSYLPGAEAVIAMFEDGRDVP
LQEGPEAGFFHARLSHAGHYRLRIRWPGGEQETADAYAFGPQLSDFDLHLIGEGRHLHLA
DALGANIVEVDGVRGTRFAVWAPNASRVAVIGDFNGWDARRHPMRLRHQVGVWELFVPDV
GPGTHYKYALRGPDGEALPAKADPVARRAERAPGTASIVADPTPFQWHDDAWMAARARRH
GPQAPISVYEVHAGAWMHDDDGHILDWDGLATRLIPYVAEMGFTHIELMPIAEYPFGGSW
GYQPLGLFAPTARFGTPEGLARFVDRCHREDIGVIIDWVPAHFPTDAHGLAHFDGTALYE
HADPREGFHRDWNTLIYNHGRCEVSGFLIASALEFLQRYHIDGLRVDAVASMLYRDYSRN
AGEWVPNHHGGRENYESIAFLRRLNQVVAEHAPGAITIAEESTAWPGVTADRAHGGLGFD
YKWNMGWMHDSLQYIARDPIYRGHHHDELRFSMVYAYSERFMLPISHDEVVHGKRSLLGR
MPGDDWQRFANLRAYLGFMYTHPGRKLLFMGCELAQPTEWNHDAALPWHLRDDPRHRGIQ
YLVRDLNRLYVEHPALHVCDDVPEGFAWVIGDDASNSVFAYLRQARDGDAPVLVVVNFTP
EVRHGYRIGVPRAGRWHEWLNSDSAIYGGSNVGNGGDVCSEALGVHGHPVSLVLTMPPLA
VLVLGYAD
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgccgtgcacgtctgggacgaggcgacgcaacacgccttcgccaccgctcag
caccgcgatccgttcgccgtgttgggcgcgcattgtctcggcgacgcgcacgtgctgcgt
agctatctgcccggagccgaagcggtgatcgccatgttcgaggacggccgcgatgtgccg
ttgcaggaggggccggaagctggcttcttccatgcgcgtttgtcgcacgctggtcactac
cgcttgcgcatccgttggcccggtggcgagcaggagacggccgacgcctacgcgttcggc
ccgcaactgagcgattttgacctgcatctgatcggcgagggacgccatctgcatctggcc
gacgcgcttggtgcaaacatagtggaagtggatggcgtgcgtggtacccgctttgcggtg
tgggcaccgaacgcctcgcgcgtggcggtgattggtgatttcaacggttgggatgcgcgc
cgccacccgatgcgcttgcgtcaccaggtcggcgtatgggaactgttcgtgcccgacgtc
ggcccaggcacgcattacaaatacgccttgcgcggcccagatggcgaagcattgcctgcg
aaggccgacccggttgcgcggcgcgccgaacgggcgcctggcaccgcttccatcgtcgcc
gacccaacgccgttccagtggcatgacgacgcctggatggcggcgcgcgcgcgccgccac
ggcccgcaggcaccgatcagcgtctacgaagtgcacgccggtgcgtggatgcacgacgac
gacggccacatactcgactgggatggcttggccacacggctgattccttatgtcgccgag
atggggttcacccacatcgaactgatgccgattgccgagtatccgttcggcggctcttgg
ggctaccagccgctggggctgttcgcgccaacggcgcgctttggcacaccggagggcttg
gcgcgtttcgtcgatcgctgccaccgtgaggacatcggcgtcatcatcgactgggtgccc
gcgcatttccccaccgacgcgcatggcctggcgcacttcgacggcaccgcactgtacgag
cacgccgacccgcgcgaaggcttccatcgcgactggaataccctgatctacaaccacgga
cgctgcgaagtgtccggtttcctcattgccagtgcgctggaattcctgcagcgctaccac
atcgacggcctgcgtgtggatgccgtggcttccatgctctaccgcgactacagccgcaat
gccggcgagtgggtgcccaaccatcatggtggccgcgagaactacgagagcatcgccttc
ctgcgtcggctcaaccaggtggtggccgagcatgcgcccggtgccatcactatcgccgaa
gaatccaccgcctggcccggcgtcaccgccgaccgcgcccacggtggcctgggcttcgac
tacaaatggaacatgggctggatgcacgatagcttgcagtacatcgcgcgtgatccgatc
taccgtggtcaccaccacgacgaactgcgtttcagcatggtttacgcctattccgagcgc
ttcatgctgccgatctcccacgacgaagtggtccacggcaaacgctccctgctcgggcgc
atgccgggcgacgactggcagcgcttcgccaacctgcgcgcctacctcggcttcatgtac
acccacccggggcgcaaattgttgttcatgggctgcgaactggcccagcccacggaatgg
aaccacgacgctgccttaccctggcacctgcgcgacgacccgcgccatcgcggcatccag
tacctagtgcgcgacctcaaccggctctatgtcgagcatcccgcgctgcacgtctgcgac
gacgttcccgaaggctttgcctgggtcatcggcgatgacgccagcaacagcgtatttgcc
tacctgcgtcaggcgcgtgacggcgacgccccagtgctggtggtggtcaacttcacccct
gaggtgcgccatggttatcgtatcggcgtcccccgtgccggccgctggcacgaatggctc
aactccgatagcgccatctatggcggtagcaacgtcggcaatggtggcgatgtttgtagc
gaggcgctcggcgttcacggtcaccccgtctccctggttctgaccatgccgccgctggcg
gtgttggtgttggggtatgcggattga

DBGET integrated database retrieval system