KEGG   Xanthomonas albilineans: XALC_2720
Entry
XALC_2720         CDS       T01160                                 
Symbol
rhlE
Name
(GenBank) probable atp-dependent rna helicase protein
  KO
K11927  ATP-dependent RNA helicase RhlE [EC:3.6.4.13]
Organism
xal  Xanthomonas albilineans
Pathway
xal03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:xal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    XALC_2720 (rhlE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:xal03019]
    XALC_2720 (rhlE)
Enzymes [BR:xal01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     XALC_2720 (rhlE)
Messenger RNA biogenesis [BR:xal03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     XALC_2720 (rhlE)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII AAA_22
Other DBs
NCBI-ProteinID: CBA17197
UniProt: D2UFN6
Position
3222323..3223693
AA seq 456 aa
MSFESLGLAPFLLRALAEQGYETPTPIQSQAIPVALQGHDLMAGAQTGTGKTAAFGLPLL
QHLGTSAQTVGSGPRKPRALILTPTRELATQVHDSLRGYSKYLRIPSATIYGGVGMGNQL
DALRRGVDLLIACPGRLLDHLERRSVDLSGIEILVLDEADRMLDMGFLPSIKRILTKLPK
QNRQTLLFSATFEEGIKQLAREFMHNPQEIQATPSNTVADTITHRVHPVDGARKRELLLH
LLAADSRKQTLVFARTKHGADKLTTFLDKSGIKAAAIHGNKSQGQRLRALGDFKASRITV
LVATDIAARGIDIDQLPQVINYDLPMVAEDYVHRIGRTGRNGAQGEAVSLVAQDEAKLLR
AIARLLKRDMDIRDVPGFEPATPIRWGNNNPPDERPGGNRPPRRGSHARRGHGDAPSHAH
AGSKKPGGHHADGARRQGQGRRQGNGGNRPPSNAPH
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgtcgttcgaatccctgggccttgcgcccttcctgctgcgtgcgctggccgagcagggc
tatgaaacccccaccccgatccagtcgcaggcgattcctgtggcactgcagggccacgac
ctgatggccggcgcgcaaaccggcaccggcaaaaccgccgcgttcggcctgccgctgctg
caacacctgggcacctcggcgcagacggtgggctcgggcccgcgcaagccacgcgcactg
atcctgaccccgacccgcgaactggccacccaggttcacgacagcctgcgcggctacagc
aagtatctgcgcattcccagcgccaccatctacggtggcgtgggcatgggcaaccagctc
gacgcgctgcgccggggcgtagatctgctgatcgcctgcccggggcgcctgctcgaccat
ctcgagcgccgcagcgtggacctgtccggcatcgagatcctggttctggacgaggccgac
cgcatgctcgacatgggcttcctgccgtcgatcaaacgcatcctgaccaagctgcccaag
caaaaccggcagaccctgttgttctcggccaccttcgaggaaggcatcaagcagttggcc
cgcgagttcatgcacaacccgcaggaaatccaggccactccgagcaacaccgtcgccgac
accatcacccaccgcgtacacccagtcgatggcgcgcgcaagcgcgaactgctgctgcac
ctgctggcggccgactcgcgcaagcagacgctggtgttcgcacgcaccaagcatggcgcc
gacaagctgaccacgttcctggacaagtccggaatcaaggccgcggcgatccacggcaac
aagagccagggccagcgtctgcgcgcgctgggtgacttcaaggccagccggatcaccgtc
ctggtggcgaccgacatcgccgcgcgcggcatcgacatcgaccagttgccgcaagtcatc
aactacgacctgccgatggtcgccgaggactacgtgcaccgcatcggccgtaccggccgc
aacggcgcccaaggcgaggcagtctcgctggtggcgcaggacgaagccaagctgctgcgc
gcgatcgcgcgcctgctcaagcgcgatatggacattcgcgacgtgccgggtttcgagcca
gccacaccgatccgctggggcaacaacaacccaccggacgagcgtccgggcggcaaccgt
ccaccgcgccgcggcagccatgcacgacgcggacacggtgatgcgccgtcgcacgcccac
gcgggcagcaagaagcccggcggccaccacgccgacggtgcccgccgccagggtcaggga
cgccgccagggcaatggcggcaaccgcccgcccagcaacgctccgcactga

DBGET integrated database retrieval system