KEGG   Xanthomonas sp. ISO98C4: AC801_07490Help
Entry
AC801_07490       CDS       T06033                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
xan  Xanthomonas sp. ISO98C4
Pathway
xan00480  Glutathione metabolism
xan00590  Arachidonic acid metabolism
xan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AC801_07490
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AC801_07490
Enzymes [BR:xan01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AC801_07490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AZU29703
UniProt: A0A3T0FWT0
Position
1747621..1748106
Genome map
AA seq 161 aa AA seqDB search
MSDISTFAFTDLEGRTQSMRDYAGNVLLVVNVASKCGFTPQYAGLQALWQCYRERGLVVI
GFPCDQFGHQEPGDAAQIRQFCSLDYAVDFPLAAKIEVNGNGAHPLWQWLKHEQRGVLGS
EAIKWNFTKFLIGRDGRVLERYAPTTKPEALAADIERALGA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgacatctccaccttcgcattcaccgacctggaaggccgcacccagtcgatgcgc
gactacgctggcaacgtcctgctggtggtcaatgttgcctccaagtgcgggtttacgccg
caatatgcggggctgcaggcgctgtggcagtgttatcgcgaacgtgggctggtggtgatc
ggctttccatgcgatcaattcgggcatcaggagccgggcgatgcggcgcagatccgccag
ttctgctcgctcgactatgcggtggattttccgctggcagcaaaaatcgaggtcaacggc
aacggcgcgcatccgctgtggcaatggctcaagcacgaacaacgcggcgtgctcgggtcc
gaagcgatcaagtggaacttcaccaagttcctgatcggccgcgacggccgcgtactggaa
cgttatgcgcccaccaccaagccggaagcgttggccgccgacatcgagcgcgcgctgggc
gcgtga

DBGET integrated database retrieval system