KEGG   Xanthomonas axonopodis Xac29-1: XAC29_01100Help
Entry
XAC29_01100       CDS       T02500                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xao  Xanthomonas axonopodis Xac29-1
Pathway
xao00071  Fatty acid degradation
xao00072  Synthesis and degradation of ketone bodies
xao00280  Valine, leucine and isoleucine degradation
xao00310  Lysine degradation
xao00362  Benzoate degradation
xao00380  Tryptophan metabolism
xao00620  Pyruvate metabolism
xao00630  Glyoxylate and dicarboxylate metabolism
xao00640  Propanoate metabolism
xao00650  Butanoate metabolism
xao00900  Terpenoid backbone biosynthesis
xao01100  Metabolic pathways
xao01110  Biosynthesis of secondary metabolites
xao01120  Microbial metabolism in diverse environments
xao01130  Biosynthesis of antibiotics
xao01200  Carbon metabolism
xao01212  Fatty acid metabolism
xao02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XAC29_01100
   00630 Glyoxylate and dicarboxylate metabolism
    XAC29_01100
   00640 Propanoate metabolism
    XAC29_01100
   00650 Butanoate metabolism
    XAC29_01100
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XAC29_01100
   00072 Synthesis and degradation of ketone bodies
    XAC29_01100
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XAC29_01100
   00310 Lysine degradation
    XAC29_01100
   00380 Tryptophan metabolism
    XAC29_01100
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XAC29_01100
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XAC29_01100
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    XAC29_01100
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xao04147]
    XAC29_01100
Enzymes [BR:xao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     XAC29_01100
Exosome [BR:xao04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XAC29_01100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGH75754
UniProt: M4TP80
Position
261873..263168
Genome map
AA seq 431 aa AA seqDB search
MPGQPMPAARPVAILGGVRIPFCRQNTAYADVGNLGMSVRTLGALVERFGLHGQQLGEVA
MGAVIKHSADWNLAREAALSSGLSPLTPGITLQRACGTSLDSVITIANKIALGQIDSGIG
GGSDTTSEVPIVYGKKLRARLLAANRAKATGDKLRALLRGFKLAELKPEFPGVAEPRTGK
SMGDHCEDMAKEWNISRDSQDEWAVASHHKLAAAYERGFFDALIAPFRGVSRDNILRADT
SLEKLATLRPAFDKTSGRGTLTAANSTPLTDGAAAVLLSSEAWALAHGHTPMAYLRDAQV
AAVDFVHGEGLLMAPTIAVPQMLARQGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCR
NRLGLDAPLGRIDPDKINPLGSSLATGHPFAATGARVVATAAKQLEERGGGRALISICTA
GGMGVVAIVER
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtcaaccgatgcccgcagcccgtcccgtcgccattctgggcggcgttcgtatc
ccgttctgtcgtcagaacaccgcctacgcggacgtgggcaacctgggcatgtcggtgcgc
acgctgggcgcgttggtcgagcgcttcgggttgcatgggcagcaattgggcgaagtggcg
atgggcgcggtgatcaagcactccgcggactggaacctggcgcgcgaggcggcgctgtcg
tcgggtctgtcgccgctgacgccgggcatcaccctgcagcgcgcctgcggcaccagcctg
gattcggtcatcaccatcgccaacaagatcgcgctggggcagatcgactcgggcatcggc
ggcggctccgacaccacctccgaagtgccgatcgtgtacggcaagaagttgcgcgcacgg
ctgctggccgccaaccgcgccaaggccaccggcgacaagctcagggcgctgctgcgcggc
ttcaagctggccgagctcaagcccgaattccccggcgtggccgagccgcgcaccggcaag
agcatgggcgaccattgcgaggacatggccaaggaatggaacatctcgcgcgattcgcag
gacgaatgggcggtggcctcgcaccacaagctggccgctgcctatgagcgcggtttcttc
gacgcgctgatcgcgccgttccgcggcgtctcgcgcgacaacatcctgcgcgccgacacc
tcgctggaaaaactcgcgaccttgcgaccggccttcgacaagacctccggccgtggcacg
ttgaccgctgccaattccaccccgctcaccgatggcgccgccgcggtgctgctctccagc
gaagcctgggcgttggcgcatggccacacgccgatggcctacctgcgcgatgcacaggtg
gcggcagtcgacttcgtgcatggcgaaggcctgctgatggcgcccaccattgcggtgccg
cagatgctggcgcgccagggcctgaccctgcaggacttcgatatctacgaaatccacgag
gccttcgccgcgcaggtgctgtgcacgctgcgcgcgtgggagagcgaggactactgccgc
aaccggctgggcctggacgcgccgctgggccgcatcgacccggacaagatcaatccgctg
ggctcgtcgctggccaccggccatccattcgccgccactggcgcacgcgtggtggccacc
gctgccaagcagttggaagagcgcggcggcggccgcgcgttgatttcgatctgcaccgcc
ggcggcatgggcgtggtggccatcgtcgagcgctga

DBGET integrated database retrieval system