KEGG   Xanthomonas axonopodis Xac29-1: XAC29_04940Help
Entry
XAC29_04940       CDS       T02500                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
xao  Xanthomonas axonopodis Xac29-1
Pathway
xao03010  Ribosome
Brite
KEGG Orthology (KO) [BR:xao00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    XAC29_04940 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:xao03011]
    XAC29_04940 (rplV)
Ribosome [BR:xao03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    XAC29_04940 (rplV)
  Bacteria
    XAC29_04940 (rplV)
  Archaea
    XAC29_04940 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AGH76510
UniProt: M4U7W0
Position
1142047..1142382
Genome map
AA seq 111 aa AA seqDB search
MEAKAILRTARISPQKARLVADQVRGLSAERAVNLLKFSDKKAAHLIKKVVESAIANAEN
NQGADVDELKVKTIMVDEGPSLKRFMARAKGRGTRILKRTSHITVVVGAAK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgaaagcaatcctgcgcaccgcgcgcatctccccgcagaaggcccgcctggtc
gctgaccaggtgcgtggtttgtccgccgagcgtgcggtcaatctgctgaagttctcggac
aagaaggctgcacacctgatcaaaaaggtggtggagtcggcgatcgccaatgccgagaac
aatcagggcgcggatgtcgacgagctgaaggtcaagaccatcatggttgatgaaggtccc
tccctgaagcgtttcatggcgcgggcgaaaggccgcggtacccgcatcctcaagcgcacc
agccacatcactgtggttgtgggcgccgccaagtaa

DBGET integrated database retrieval system