KEGG   Xanthomonas axonopodis Xac29-1: XAC29_05720Help
Entry
XAC29_05720       CDS       T02500                                 

Gene name
acnA
Definition
(GenBank) aconitate hydratase
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
xao  Xanthomonas axonopodis Xac29-1
Pathway
xao00640  Propanoate metabolism
xao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    XAC29_05720 (acnA)
Enzymes [BR:xao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     XAC29_05720 (acnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AGH76657
UniProt: M4TV03
Position
1292890..1295481
Genome map
AA seq 863 aa AA seqDB search
MNSQYRKPLPGTSLDYFDARAAVDALQPGAYATLPYTARVHAENLVRRAEPQLLEAYLRQ
LIERKRELDFPWFPARVVCHDILGQTALVDLAGLRDAIAEQGGDPAQVNPVVPVQLIVDH
SLAVEYAGFDKQAFAKNRSVEDRRNADRFHFIEWTKRAFENMEVIPPGNGIMHQINLEKM
SPVIYTLDGVAFPDTCVGTDSHTPHVDALGVIAVGVGGLEAENVMLGRASWMRLPDIIGV
ELTGRPAPGITATDIVLALTEFLRAQRVVGAYLEFYGDGARALTIGDRATISNMTPEFGA
TAAMFSIDQQTIDYLRLTGRDDAQVALVETYARHTGLWADDLATAQYERVLQFDLASVVR
NMAGPSNPHKRVATTALADRGIAGAWEQVPGKMPDGAVIIAAITSCTNTSNPRNVIAAGL
LARNANARGLTRKPWVKSSLAPGSKAVQLYLEEAGLLSELEQLGFGIVAFACTTCNGMSG
ALDPAIQQEVIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVIAYAIAGTVRFDIE
KDVLGIDADGVPVTLKDLWPSDAEIDAVVARSVKPEHFRSVYDPMFKRSAGQGISVNPLY
EWRPASTYIRRPPYWEGALAGARTLLGMRPLAVLGDNITTDHLSPSNAIMAGSAAGQYLA
QMGVPEEDFNSYATHRGDHLTAQRATFANPKLINEMAVVDGQIKAGSLARLEPEGQVLRM
WEAIETYMTRKQPLIIIAGADYGQGSSRDWAAKGVRLAGVEVIVAEGFERIHRTNLIGMG
VLPLEFKPGTDRRTLGIDGSETFDVVGERTPGATLTLSIHRRDGEQLQVPVTCRLDTAEE
VSIYEAGGVLQRFAQDFLEASAA
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgaatagccagtaccgcaagcccttgccgggcacctcgttggattacttcgatgcacgc
gctgccgtcgatgcgctgcagcccggtgcgtatgcgaccttgccgtacaccgcacgcgtg
catgccgagaacctggtgcggcgtgcagagccgcaactgctggaggcgtacctgcggcag
ttgatcgagcgcaagcgcgagctggatttcccgtggtttccggcacgtgtggtgtgtcac
gacatcctgggccagaccgcattggtcgatcttgccggcttgcgcgatgccattgccgag
cagggcggcgacccggcacaagtcaatccggtggtgccggtgcagttgatcgtggatcac
tcgctggcagtggaatacgccggcttcgacaagcaggcgttcgccaagaatcgcagcgtg
gaagatcgccgcaacgccgatcgcttccacttcatcgaatggaccaagcgtgcgttcgag
aacatggaagtgattccgccaggcaacgggatcatgcatcagatcaatctggagaagatg
tcgccagtgatctacacgctcgatggcgtggcgttcccggatacctgtgtgggcaccgac
agccacacgccgcatgtggatgcgctgggcgtgatcgcggtgggcgtcggcgggttggaa
gcggagaacgtgatgctgggccgcgcctcgtggatgcgcctgccggacatcatcggcgtg
gaattgaccggccggccggcgcctggcatcaccgccaccgacatcgtgctggcattgacc
gaattcctgcgcgcgcaacgcgtggttggggcgtatctcgagttttacggggatggtgcg
cgggcgctgaccatcggcgaccgcgcgaccatttccaacatgacgccggaattcggtgcg
acggcggcgatgttctctatcgaccagcagaccatcgactacctgcggctcactggtcgc
gacgatgcgcaggtcgcattggtggagacctatgcgcggcataccggcctatgggcagac
gatctggccaccgcgcagtacgagcgcgtgctgcagttcgatctggcgagcgtggtgcgc
aacatggccgggccgtccaatccgcacaaacgcgtggccaccaccgcactggcggatcgt
ggcattgccggtgcgtgggagcaggtgccggggaagatgcccgatggcgcagtaatcatc
gcagcgatcacctcgtgcaccaatacctcgaacccgcgcaacgtgattgctgccggtttg
ctggcgcgcaatgccaatgcgcgtggcttgacccgcaagccgtgggtgaaaagctcgctg
gctccgggatccaaggcagtgcaactgtacctggaagaagccgggttactgagcgagctg
gaacaattgggcttcggcatcgtggcgtttgcctgcaccacctgcaatggcatgagcggg
gcgctggatcctgcgatccagcaggaagtcatcgatcgcgatctgtatgccacggcggtg
ctgtcgggcaaccggaatttcgatgggcgcatccatccgtatgccaagcaggcgtttctt
gcttcgccgccgctggtgattgcctatgccattgccggcaccgtgcgcttcgatatcgag
aaggatgtgttgggcatcgacgccgacggcgtgccggtcacgctcaaggatctgtggccg
agcgatgccgagatcgacgcagtggtggcgcgcagcgtcaagccggaacacttccgcagc
gtgtacgacccgatgttcaagcgcagcgcggggcaggggatcagcgtgaacccgttgtac
gagtggcgcccggccagcacgtatattcggcgcccgccgtactgggaaggcgccttggcc
ggcgcgcgcacgctgctcggcatgcgcccgttggccgtgctgggcgacaacatcaccacc
gatcacctgtcgccgtcgaacgcgatcatggccggcagtgccgccgggcaatatctggcg
caaatgggcgtgccggaggaggacttcaattcctacgccacccatcgcggcgaccacctc
accgcccagcgtgcgacgtttgccaaccccaagttgatcaacgaaatggcggtggtcgat
gggcagatcaaagccggctcgctggcccggctggagccggagggccaggtgctacgcatg
tgggaggcgatcgaaacctatatgacgcgcaagcagccgttgatcatcattgccggcgcc
gattacgggcagggctcgtcgcgcgactgggcagccaagggtgtgcggcttgccggtgtg
gaagtgattgtcgccgaaggcttcgagcggattcaccgtaccaacttgatcggcatgggc
gtgctgccgctggagttcaagccgggcaccgaccgcaggaccttgggcatcgatggcagc
gaaactttcgacgtggtgggtgagcgcacgccgggcgccacgctgacgttgtcgatccat
cggcgtgatggcgagcagctgcaggtgccggtgacctgccgactggatactgcagaggaa
gtgtcgatttacgaagccggtggcgtgttgcagcggtttgcgcaggattttctggaagcc
tcggctgcctga

DBGET integrated database retrieval system