KEGG   Xanthomonas axonopodis Xac29-1: XAC29_06725Help
Entry
XAC29_06725       CDS       T02500                                 

Definition
(GenBank) beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
xao  Xanthomonas axonopodis Xac29-1
Pathway
xao00520  Amino sugar and nucleotide sugar metabolism
xao01100  Metabolic pathways
xao01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:xao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    XAC29_06725
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    XAC29_06725
Enzymes [BR:xao01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     XAC29_06725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: AGH76843
UniProt: M4TRY2
Position
1543214..1544218
Genome map
AA seq 334 aa AA seqDB search
MLLIGVAGTELSAQERDWLQHDAVAGVVLFKRNFASRTQVAELSAAIRAAAPRPVLICVD
QEGGRVQRFREGFSALAPLQSFGAQYAQDPEAALAAARAHAQLMASEVRASGVDLSFAPV
VDLGRGNRAIGDRAFSDEPQIVATFTRAYVQALHGAGMAATLKHFPGHGTVLEDTHVDHA
SDPRPLEVLQAEDLVPFVAGIEAGADAVMMAHVVYPQVAPEPAGYSQRWIEQILRGQMGF
RGVVFSDDIGMAASFSAGGVAGRVHAHLDAGCDVVLVCHPELVAESLQAVQGRSLNTAAL
IGLIGRGALGWDGLLAGTDASFTTPLSAHFGTTA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcttctgatcggcgttgccggtaccgaactcagcgcacaggaacgcgattggctgcag
cacgatgcggttgccggcgtggtgctgttcaagcgcaacttcgcctcgcgcacccaggtg
gccgagctgtcggccgccattcgcgccgccgcgccgcgcccggtgctgatctgcgtggac
caggaaggtgggcgcgtgcagcggtttcgcgaaggattcagcgcgctggcgccgttgcaa
agcttcggtgcgcaatacgcccaggacccggaggctgcactggccgccgcgcgcgcgcat
gcgcagttgatggccagcgaagtccgcgccagcggcgtggacctgagctttgcgccggtg
gtggacctgggccgcggcaaccgggccattggcgatcgcgccttcagcgatgagccgcag
atcgtggccaccttcacgcgcgcctatgtacaggcgctgcatggggccggcatggccgcc
acgctcaagcatttccccggccacggcaccgtgctggaagacacccatgtcgaccacgcc
agcgacccgcggccgctggaggtgctgcaggccgaagacctggtgccgttcgtggcgggg
atcgaggccggcgccgacgccgtgatgatggcgcacgtggtctacccgcaggtcgccccg
gagccggccggctattcgcagcgctggatcgagcagatcctgcgcggccagatgggcttc
cgcggcgtggtcttttccgacgacatcggcatggccgcctcgttcagtgccggcggggtg
gcgggtcgtgtgcatgcgcatctggatgccggctgcgacgtggtgctggtgtgccacccg
gaactggtcgccgaatcgctgcaggccgtgcagggccgcagcctcaataccgccgcattg
atcggcctgatcggccgcggcgcactaggttgggatggcctgctcgccggcaccgatgcc
tcatttaccactcctctttctgcccatttcggaacaactgcctga

DBGET integrated database retrieval system