KEGG   Xanthomonas arboricola: XB05_02850Help
Entry
XB05_02850        CDS       T06096                                 

Definition
(GenBank) vitamin B12 ABC transporter permease
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
xar  Xanthomonas arboricola
Pathway
xar00480  Glutathione metabolism
xar00590  Arachidonic acid metabolism
xar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xar00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    XB05_02850
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    XB05_02850
Enzymes [BR:xar01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     XB05_02850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AKC77798
UniProt: A0A0E3YKT4
Position
686814..687371
Genome map
AA seq 185 aa AA seqDB search
MLLKRLLVVVFAGFFSVSALAAGAPVLDLDYRPLAGKAPINLNRTYGGKVVMVVNTASKC
GYTPQYEGLEALNQRFGSRGFSVLGFPSNDFQGQEPGSEKQIQEFCTLTYGVKFPMFEKV
HVLGAQATPLYQRLTQATGVAPGWNFHKYLIGRNGRVVAQFPSKIKPDDPSVLAAIEREL
NAPSR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgttgctcaagcgtctgctggtcgttgtattcgctggctttttctccgtctcggcgctg
gccgccggcgcgccggtgctggatctggattaccggccgttggccggcaaggcgccaatc
aacctgaaccgtacctacggcggcaaggtggtgatggtggtcaataccgccagcaagtgc
ggctacacgccgcagtacgaagggctggaggcgctcaaccagcgtttcggcagccgcggt
ttttcggtgctgggctttccgtccaacgatttccaggggcaggaacccggatctgagaag
cagatccaggaattctgcacgctgacctatggcgtcaagttcccgatgtttgagaaggtg
catgtgctgggtgcacaggccacgccgctgtatcagcgcctgacccaggccaccggtgtg
gcgccgggctggaacttccacaagtatctgatcggtcgcaatggacgggtggtggcgcag
ttccccagcaagatcaaaccggacgatccgagcgtgctggcggcaatcgaacgcgagctc
aacgcgccgtcgcgctga

DBGET integrated database retrieval system