KEGG   Xanthobacter autotrophicus: Xaut_0071Help
Entry
Xaut_0071         CDS       T00581                                 

Definition
(GenBank) Aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00350  Tyrosine metabolism
xau00360  Phenylalanine metabolism
xau00380  Tryptophan metabolism
xau01100  Metabolic pathways
xau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Xaut_0071
   00360 Phenylalanine metabolism
    Xaut_0071
   00380 Tryptophan metabolism
    Xaut_0071
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xau04147]
    Xaut_0071
Enzymes [BR:xau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     Xaut_0071
    4.1.1.105  L-tryptophan decarboxylase
     Xaut_0071
Exosome [BR:xau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Xaut_0071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC DUF4129 Aminotran_5 Beta_elim_lyase OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: ABS65330
UniProt: A7IBD7
Position
77388..78812
Genome map
AA seq 474 aa AA seqDB search
MDGEAFRHWAHKAADWAADYRAGLRDRPVRAGTTPGEIVAQLPASAPEEAEPMADIFADF
ERILVPGMTHWQHPRFFAYFPANASPASVIGEFLSSAMGAQCLLWQTSPAATELEIVALD
WLRQAVGLPEGFSGVIQDSASSATLCAFLTMRERALGFTGNRTGLAGRPQLRVYTSSEVH
TSIDRAAWFCGIGDDNLVRIPTQGPLRSMVPQALEAAIQADKAAGFVPAGVVACVGGTST
GAMDDVAAVVEVAHRHGLFVHVDAAWAGSAMVCPEFRSLWAGVEQADSIVLNPHKWLGVQ
FDCSAHFLRSADDHLATLAIQPEYLRTHAHEGGDTGIVNFSEWTIQLGRRFRALKLWFVL
RAHGLEGLRQMIRNHVAWSQALAARIACEPGFSLASTPVLSLFSFRHDPGDGRDGDAHML
ALLQAINDGGQLYLTPTRVDGRLAIRFQAGSMDATADDVDAAFHIIRDTAHALS
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggacggggaggcgttccgccactgggcgcacaaggcggcggactgggcggcggactat
cgcgccggcctgcgcgaccggccggtgcgcgccggcaccacgccgggggagatcgtggcc
cagctgccggcttccgctccggaagaggccgagcccatggccgacatcttcgcggatttc
gagcgtatcctggtgccgggcatgacccattggcagcatccgcgcttcttcgcctacttc
ccggccaatgccagccccgcgagcgtgatcggcgagttcctgtcctccgccatgggcgcc
cagtgcctgctgtggcagacctcccctgccgccacggagctggagattgtcgccctcgac
tggctgcgccaggcggtgggcctgccggaagggttttccggcgtgatccaggattcggcg
tcctcggcgaccttgtgcgccttcctcaccatgcgcgagcgggcgctgggcttcaccggc
aaccgaaccgggcttgcgggccggccgcagctgcgggtctacacctccagcgaggtgcat
acctccatcgaccgggcggcgtggttctgcggcatcggcgacgacaatctggtgcgcatc
cccacccagggcccgctcaggagcatggtgccgcaggcgctggaggcggccattcaggcc
gacaaggcggccgggttcgtgccggcgggcgtcgtcgcctgcgtgggtggcaccagcacc
ggcgccatggatgacgtggcggccgtggtggaggtggcgcaccggcatggcctgttcgtc
catgtggacgcggcctgggcgggctcagccatggtgtgcccggaattccggtccctgtgg
gcgggggtggaacaggccgactccatcgtgctgaacccgcacaagtggctcggggttcag
ttcgactgctccgcccatttcctcaggagcgccgacgaccatctggcgacgctcgccatc
cagccggaatatctgaggacccacgcccatgagggcggggataccggcatcgtcaatttc
agcgaatggaccatccagctcggccgccgcttccgcgcgctgaaactgtggttcgtgctg
cgcgcccatggcctggaaggcctcaggcagatgatccgcaaccatgtggcctggtcgcag
gcgctggccgcgcgcatcgcctgcgagccgggcttctcgctggcctcgacgcctgtgctg
tccctgttctccttccgccacgatcccggcgacggccgcgacggcgatgcccacatgctg
gccctgctgcaggccatcaatgacggggggcagctctatctcaccccgacccgggtggac
ggccgcctcgccatccgcttccaggccgggtccatggacgccaccgcggacgacgtggac
gccgctttccacatcatccgcgacaccgctcacgccttgtcctga

DBGET integrated database retrieval system