KEGG   Xanthobacter autotrophicus: Xaut_0470Help
Entry
Xaut_0470         CDS       T00581                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
xau  Xanthobacter autotrophicus
Brite
KEGG Orthology (KO) [BR:xau00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Xaut_0470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 LTD
Motif
Other DBs
NCBI-ProteinID: ABS65728
UniProt: A7ICI5
Position
complement(514475..514867)
Genome map
AA seq 130 aa AA seqDB search
MYRAITRNIQVTATPRYVAERSEPDQGRHFWAYTVEVANLGQETVQLKGRHWVITDANGH
TEEVHGAGVVGEEPTLPPGGRFEYTSGVPLNTSTGIMSGHYEMLADNGETFSIEIPAFSL
DVPDVRRVLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgcgccatcactcggaatattcaggtgaccgcgacgccgcgttatgtggcggag
cgatcggagcccgaccagggccgtcatttttgggcttataccgtcgaggtggccaatttg
ggccaggagaccgtgcaactgaagggtcgccactgggtcattaccgacgccaacgggcac
accgaggaggtccacggcgccggtgtcgtgggcgaggagcccaccctgccgcccggcggc
cgattcgaatacaccagcggcgtgccgctcaacacctccaccgggatcatgagcgggcac
tacgagatgctggccgacaacggcgagaccttctccatcgagatccccgccttctcgctg
gatgtgccggacgtgcgccgcgtcctgaactga

DBGET integrated database retrieval system