KEGG   Xanthobacter autotrophicus: Xaut_0490Help
Entry
Xaut_0490         CDS       T00581                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00020  Citrate cycle (TCA cycle)
xau00640  Propanoate metabolism
xau00660  C5-Branched dibasic acid metabolism
xau01100  Metabolic pathways
xau01110  Biosynthesis of secondary metabolites
xau01120  Microbial metabolism in diverse environments
xau01130  Biosynthesis of antibiotics
xau01200  Carbon metabolism
Module
xau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Xaut_0490
   00640 Propanoate metabolism
    Xaut_0490
   00660 C5-Branched dibasic acid metabolism
    Xaut_0490
Enzymes [BR:xau01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Xaut_0490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 Citrate_bind Peripla_BP_3 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ABS65748
UniProt: A7ICK5
Position
543958..545190
Genome map
AA seq 410 aa AA seqDB search
MRGPRRGRNPMNIHEYQAKALLKEFGVPVSRGLAAFTPQDAEAAAAKLGGIAFVVKAQIH
AGGRGKGKFKELPAEAKGGVRVVKTAADVKANAAEMLGNTLVTIQTGPDGKQVNRLYIEE
GASIDKEFYLSMLVDRATARVAFVVSTEGGMDIEEVAHATPERIVTFSVDPATGVQPLHG
RKVAQALGLSGDLAKQAVALTANLYRAFTDKDMSLLEINPLVLTRDDRLVCLDAKVGFDS
NALFRHPEVVQLRDESEEDFKEIEASRYDLSYIALDGTIGCMVNGAGLAMATMDIIKLYG
REPANFLDVGGGATKEKVTAAFKIITADPNVEGILVNIFGGIMRCDVIAEGVIAAVRQMG
LNVPLVVRLAGTNVEEGKKIIRESGLNVIPADDLDDAAQKIVAAVKKEAA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggccctcgtcgagggaggaaccccatgaacattcacgagtaccaggcgaaagcc
cttctcaaggaattcggcgtgccggtgtcgcgcggccttgccgccttcacgccacaggac
gcggaagccgccgccgcgaagctgggcggcatcgcgttcgtggtgaaggcacagatccat
gcgggcgggcgcggcaagggcaagttcaaggaactgcccgcagaggccaagggcggtgtg
cgggtggtgaagaccgccgccgacgtgaaggcgaatgccgcggagatgctcggtaatact
ctggtgaccatccagaccgggccggacggcaagcaggtgaaccgcctctatattgaggaa
ggcgcctccatcgacaaggaattctacctgtccatgctggtggaccgcgccaccgcgcgc
gtcgccttcgtggtctccactgagggcggcatggacatcgaggaggtggcccatgccacc
cccgagcgcatcgtcaccttctccgtggacccggccaccggcgtgcagcccctgcacggc
cgcaaggtggcgcaggcgctgggcctgtccggcgacctcgccaagcaggcggtggcgctg
acggcaaacctctatcgcgccttcaccgataaggacatgagccttctggagatcaacccc
ctggtgctgacgcgggacgatcgcctcgtctgcctcgacgccaaggtggggtttgattcc
aacgccctgttccgccatccggaggtggtgcaactgcgcgacgagagcgaggaggacttc
aaggagatcgaagcctcgcgctacgacctgtcctatatcgccctcgacggcaccatcggc
tgcatggtcaacggcgcgggcctcgccatggccaccatggacatcatcaaactctacggc
cgcgagccggcgaacttcctggacgtgggtggcggcgccaccaaggagaaggtgacggcc
gccttcaagatcatcaccgccgatcccaatgtcgagggaatcctggtgaacatcttcggc
ggcatcatgcgctgcgacgtgatcgcggagggcgtcatcgccgctgtgcgccagatgggg
ctgaacgtgcccctcgtggtaaggcttgccggcaccaacgtggaagaaggcaagaagatc
atccgggaatcgggtctgaacgtgatcccggcggatgacctcgatgacgcggcgcagaag
attgtcgcggccgtgaagaaggaagctgcgtga

DBGET integrated database retrieval system