KEGG   Xanthobacter autotrophicus: Xaut_0599
Entry
Xaut_0599         CDS       T00581                                 

Definition
(GenBank) P-type conjugative transfer protein TrbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
xau  Xanthobacter autotrophicus
Pathway
xau02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:xau00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Xaut_0599
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xau02044]
    Xaut_0599
Secretion system [BR:xau02044]
 Type IV secretion system
  Trb secretion system protein
   Xaut_0599
SSDB
Motif
Pfam: DUF4141 Hypoth_Ymh DUF4524 LicD
Other DBs
NCBI-ProteinID: ABS65855
UniProt: A7ICW2
Position
673279..674013
AA seq 244 aa
MIRRSLRAVLVAAPLLFCPFAPAVAQYVVYDPSNYAQNVLQAARALQQVTNQITSLQNEA
QMLINQTRNLANLPYSSISAFQQAAQRTQQLLGQAQKIAYDVTAIDRAFQGQYGSVSLSS
SDAALVTQAKSRWETTVAGLQDALRVQAGVVGNLDTGRSQASTLVGQSQAASGALQAMQA
GNQLQALQAQQLSDLTAVITANGRAQALSEAERATAVSEGQERYRRFSTRSSYQPAAVTM
FHGK
NT seq 735 nt   +upstreamnt  +downstreamnt
atgatccgccgttcattgcgggcggtgctcgtcgccgcgccgcttcttttctgcccgttc
gcgccggccgtggcgcagtacgtggtctacgacccctccaactatgcccagaacgtcctt
caagctgctcgggcgctacagcaggtcaccaaccagatcacctcgcttcagaacgaagcg
cagatgctgatcaatcagacccgcaatcttgcgaacctgccttattcctctatcagcgca
ttccagcaggcggcccagcgcacccagcaattgctcggtcaggcccagaagatcgcctat
gacgtcaccgccatcgaccgggcgtttcagggccagtatggctcggtctccctgagcagt
tcggatgccgcccttgtcacccaggcgaagagccgctgggagaccacggtcgccggcctc
caggatgcgctgcgggtgcaggcgggcgtcgtcggcaatctcgacaccggccgctcgcag
gcctcgacactggtcggccagagccaggcggcgagcggcgcgctgcaggccatgcaggcg
ggcaaccagcttcaggcgctccaggcccagcagctctccgacctcaccgccgtgatcacg
gcgaacggccgcgcacaggccctgtccgaagctgagcgggcgacggcggtgtcggaaggg
caggagcgctaccggcgcttctccacccggtcgagctaccagcctgccgccgtcaccatg
ttccacggcaagtga

DBGET integrated database retrieval system