KEGG   Xanthobacter autotrophicus: Xaut_0602
Entry
Xaut_0602         CDS       T00581                                 

Definition
(GenBank) Conjugal transfer protein
  KO
K20531  type IV secretion system protein TrbF
Organism
xau  Xanthobacter autotrophicus
Pathway
xau02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:xau00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Xaut_0602
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xau02044]
    Xaut_0602
Secretion system [BR:xau02044]
 Type IV secretion system
  Trb secretion system protein
   Xaut_0602
SSDB
Motif
Pfam: VirB8
Other DBs
NCBI-ProteinID: ABS65858
UniProt: A7ICW5
Position
675500..676189
AA seq 229 aa
MTPFKRPAVHYGRAPEPETPYHRAAQVWDDRIGSARVQAKNWRLMAFGCLALSAGLSGAL
AWQALSGSVVPWVVQVDKLGLAQAVAPASSDYRPSDPQIAFHLARFIEEVRSISADPVIV
RQNWLRAYAYTTQAGAVALNDYARANDPFARVGKQQVAVEVSSVIRASPDSFRIAWTERR
YQDGSLADNARWSAILTVVVQAPRDAERLRANPLGIYVNAINWSKELAQ
NT seq 690 nt   +upstreamnt  +downstreamnt
atgaccccgttcaagcgacctgcggttcattacggccgcgcacccgagcccgagacgccg
tatcatcgcgcggcccaggtctgggacgatcgcatcggctcggcccgcgtccaggcgaag
aactggcgcctcatggcgttcggctgcctggcgctttcggccggcctctccggggccctg
gcctggcaggccctgagcggctcggtggtgccgtgggtcgtccaggtggacaagctgggg
ctggcgcaggccgtggcacctgcatcgtcagattatcgcccctccgatccccagatcgcc
ttccacctcgctcgcttcatcgaggaggtgcgcagcatctccgccgatcccgtcatcgtc
cggcagaactggctcagggcctatgcctacacgacgcaagccggagcggttgccctcaac
gactatgcccgggccaacgatcccttcgcccgggtcggcaagcagcaggtggcggtggag
gtctcgagcgtcatccgtgcctcgccggactccttccgcatcgcctggaccgaacgccgc
taccaggacggcagcctcgccgacaacgcacgctggagcgccatcctcaccgtcgtggtg
caggcgccgcgggacgccgagcgcctccgggccaatcccctcgggatctacgtcaacgcc
atcaactggtcgaaggagctcgcacaatga

DBGET integrated database retrieval system