KEGG   Xanthobacter autotrophicus: Xaut_0696
Entry
Xaut_0696         CDS       T00581                                 
Name
(GenBank) AAA ATPase
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:xau00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Xaut_0696
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xau02044]
    Xaut_0696
Enzymes [BR:xau01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Xaut_0696
Secretion system [BR:xau02044]
 Type IV secretion system
  Trb secretion system protein
   Xaut_0696
SSDB
Motif
Pfam: P-loop_TraG CagE_TrbE_VirB AAA_22 AAA_10 AAA_29 AAA_16 ABC_tran TraG-D_C HerA_C FtsK_SpoIIIE DUF87 AAA_7
Other DBs
NCBI-ProteinID: ABS65948
UniProt: A7ID55
Position
complement(785308..787851)
AA seq 847 aa
MMNLAEYRRTATRLADYLPWAALSGSGVVLNKDGSFQRTAKFRGPDLDSSVAAELVAVAG
RINNALRRLGSGWSIFVEAQRSGAATYPESLFPDPASALVDAERKAAFEEAGAHFVSGYF
LTFLWLPPAEDSARAETWLYEGRAQSGVNLWELLRGFVDRTDRVLALLDGFMPECRWLDD
AETLTYLHSTISTNRHRVRVPEVPMHLDALLADQPLTGGLEPRLGDQHLRVLTIIGFPTA
TTPGLLDEMNRLAFPYRWSTRAILLDKLEATRLLTKIRRQWFAKRKSIAAIVKEVMTNEQ
SALVDTDAANKAADADMALQELGQDMAGMAYVTATITVWDADPRIADEKLRLAEKVVQGR
DFTAMAETVNAVDAWLGSLPGHAYANVRQPPISTLNLAHMIPLSAVWAGPERNDHLGAPP
LLYGKTEGSTPFRLSLHIGDVGHTLVVGPTGAGKSVLLALMALQFRRYEKAQVFAFDFGG
SIRAAALAMGGNWHDLGGGLTDGSDASVSLQPLSRIDDAYERSWAADWIGAILTREGVAV
TPEVKEHIWTALSSLASAPSGERTITGLAVLLQSNDLKQALRPYCVGGPYGRLLDAETEH
LGAADVQAFEIEGLVGTGAAPAVLSYLFHRIGDRLDGRPTLLIIDEGWLALDDDGFSGQL
REWLKTLRKKNASVIFATQSLSDIDDSAIAPAIIESCPTRLLLPNERAIEPQITAIYRRF
GLNDRQIEILARATPKRDYYCQSRRGNRLFELGLSEVGLALCAASSKSDQAAIERIHAEH
GTDGFLAAWLRHRGVDWAADLIPGLTNLVPGPPSDPEDESAIGIASHAGHQDEFPIDEEF
SQEEIDL
NT seq 2544 nt   +upstreamnt  +downstreamnt
atgatgaacctggccgaataccgccgcaccgccactcgcctggccgactatctgccctgg
gccgcattgtccggatccggcgtggtgctgaacaaggatggcagcttccagaggacggcg
aagtttcgtgggccggacctggattcgtcggtcgccgccgaactggtcgccgtggctggc
cgcatcaacaatgccctccgtcgtctcggttccggctggtcgatctttgtcgaggcgcag
cgcagcggggccgcgacctatcccgaaagcctgtttcccgatccggcctcggccttggtc
gacgccgagcgcaaggccgcattcgaggaggccggcgcccatttcgtgtcgggctatttc
ctgaccttcctctggctgccgccggccgaggattccgcgcgtgccgagacctggctctat
gagggccgcgcgcaatcgggcgtcaacctctgggagttgctgcgcggtttcgtggatcgc
accgaccgcgttctggccctgctcgacggcttcatgcctgaatgccgttggctcgatgac
gccgagacgctgacctatctccactcgacgatctcgaccaaccggcatcgcgtgcgcgtg
ccggaggtgccgatgcatctcgatgcgttgcttgccgaccagccgctgaccggcgggctg
gagccgcgcctcggagatcagcatctgcgtgtcctcaccatcatcggctttcccacggcc
acgacgcccggcctgctggatgaaatgaaccggctggcatttccctatcgctggagcacg
cgggcgatcctcctcgacaagctcgaagcgacaaggctgctcaccaaaatccgccggcaa
tggttcgccaagcgcaagtcgatcgccgcgatcgtcaaggaggtgatgaccaacgagcaa
tccgcactggtcgacaccgatgcggccaacaaggccgccgacgccgatatggccctccag
gaacttgggcaggacatggcgggcatggcctatgtcacggccaccatcacggtctgggat
gccgatccgcgcatcgccgacgaaaagctgcggctcgccgagaaggtcgttcagggccgc
gatttcacggcaatggccgagaccgtcaacgcggtcgatgcctggctcggctctctgccc
ggtcatgcctatgccaatgtccggcagccgccgatctcgacactcaatcttgcccacatg
atccccttgagtgctgtgtgggcagggccggaacggaacgaccatctcggtgcgcccccc
ttgctctatggcaagaccgagggaagtacgccgttccggctttccctccatatcggggat
gtcggccacacgctcgtcgtcggcccgaccggcgcgggcaaatcggtgttgctggcgctg
atggcgctccagttccgccgttacgagaaagcccaggtcttcgccttcgacttcggcggc
tccatccgagccgcggcgctcgccatgggcgggaactggcatgatttgggcggcggattg
accgatgggtcggacgcctcggtgtcgctgcaaccgctctcccgcatcgacgatgcctat
gagcgttcctgggctgccgactggatcggcgcgatcctgacgcgagagggtgtcgccgtc
acgccggaggtgaaggagcacatctggacggcgctgtcctcgctcgcgtccgcgccctcc
ggcgagcgcaccatcaccggcctcgccgtgctgctgcaatccaatgacctcaaacaggca
ctgcgaccctattgtgtcggcggtccctatggccgtcttcttgacgccgagaccgagcac
ctcggcgccgccgacgtgcaggcattcgagatcgaggggctcgtcggaaccggagcggcg
cctgcggtcctgtcctacctgttccatcggatcggcgaccggctcgatggccgcccgacg
ctgctcatcatcgacgagggctggctcgccctcgacgatgacggtttctccggtcagctc
cgcgaatggctgaaaacgctccgcaagaagaacgcctcggtcattttcgccacgcagagc
ctgtcggacatcgatgacagcgcgatcgcgcccgccatcatcgagagctgcccgacgcgg
ctgctcctgccaaacgagcgcgcgatcgagccgcagatcacggccatctatcgccgcttc
ggtctcaacgaccggcagatcgagatcctcgcgcgggcaaccccgaagcgggactattat
tgccagtctcgacgcggcaaccggctgttcgagctcggattgagcgaggtgggactcgcg
ctctgcgccgcatcttctaaatccgatcaggcagccatcgagcgcatccacgccgagcat
gggaccgacggtttcctcgccgcctggctgcgccatcgcggcgtggactgggccgccgac
ctgatccccggcctcaccaatctcgtcccggggccgccttcggatccggaggatgagtcg
gcaataggcatcgcgagccatgccgggcaccaagacgaattcccgatcgatgaagagttc
agccaagaggagatcgacctgtga

DBGET integrated database retrieval system