KEGG   Xanthobacter autotrophicus: Xaut_0698Help
Entry
Xaut_0698         CDS       T00581                                 

Definition
(GenBank) Conjugal transfer protein TrbC
  KO
K20528  type IV secretion system protein TrbC
Organism
xau  Xanthobacter autotrophicus
Pathway
xau02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:xau00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Xaut_0698
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xau02044]
    Xaut_0698
Secretion system [BR:xau02044]
 Type IV secretion system
  Trb secretion system protein
   Xaut_0698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbC
Motif
Other DBs
NCBI-ProteinID: ABS65950
UniProt: A7ID57
Position
complement(788143..788475)
Genome map
AA seq 110 aa AA seqDB search
MIRHALRMRRHVATAAAVTYVSLFMAPAAHASGSSMPWEAPLQSILESIEGPVAKIIAVI
IIIVTGLTLAFGDTSGGFRRLIQIVFGISIAFAASSFFLSFFSFGGGALI
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtcacgccttgcgcatgcgccgtcacgtcgcgacagccgcggccgtcacctat
gtcagcctgttcatggccccggccgctcatgcgtccgggtcatccatgccctgggaggcg
ccgctccagagcattctcgaatcgatcgagggaccggtcgcgaagatcatcgccgtcatc
attatcatcgtgaccggcctgacgctggccttcggcgacacctctggcggcttccggcga
ctgatccagatcgtcttcggcatctccatcgccttcgcggcatcgagcttctttctgtcc
ttcttctcgtttggtggcggggcgctcatctga

DBGET integrated database retrieval system