KEGG   Xanthobacter autotrophicus: Xaut_1037Help
Entry
Xaut_1037         CDS       T00581                                 

Definition
(GenBank) alpha/beta hydrolase fold
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
xau  Xanthobacter autotrophicus
Brite
Enzymes [BR:xau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Xaut_1037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 DLH Abhydrolase_3 Thioesterase Ser_hydrolase Esterase Abhydrolase_5 Glyco_trans_4_5 LIDHydrolase
Motif
Other DBs
NCBI-ProteinID: ABS66288
UniProt: A7IE45
Position
complement(1190298..1191194)
Genome map
AA seq 298 aa AA seqDB search
MPVDRSIMIEGGPIGVLLIHGLGGTPVELREVARRLAATGATVLCCQLAGHCGTEEELAA
TRFEDWYASAEAALAALEARCTKVVVGGLSMGALLAALLAARNPDSVDGVVMLAPTLRYD
GWSIPRYGFLLRLLINTPLGRRYRFVEREPYGLKDERIRAMILRAMRRGDTDAGSLGTPS
AALKQLWRLVARLKPLLGSIRQPVFIAHARHDDVASFNNAVLLQRRLGGTVECLVLDDSY
HLVTLDRQRHLVTDRVAAFIRGVVAAPNRHPVLEPRRAAAARAERNAPIAAAEVAHVA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtggaccgcagcatcatgatcgagggcggccccatcggggtgctgctcatccac
ggcctcggcggcaccccggtggaactgcgcgaggtcgcgcgccggctcgcagccacgggt
gccaccgttctgtgctgccagctcgccggccattgcggcaccgaggaggaactggccgcc
acacggttcgaggactggtacgccagcgccgaggccgccctcgcggcgctggaggcgcgc
tgcaccaaggtggtggtgggtggcctctccatgggggcgctgctggccgccctgctcgcc
gcccgcaaccccgacagcgtggacggggtggtaatgctggccccgaccctgcgctatgac
ggctggtccatcccccgctacggcttcctgctgcgcctgctcatcaatacgccgctgggc
cggcgctatcgcttcgtggagcgagagccctacggcctgaaggacgagcgcatccgggcc
atgattttgcgcgccatgcgacggggcgataccgatgccggcagcctcggcaccccctcc
gccgccctgaagcagctgtggcggctggtggcgcggctgaagccgctgctcggctccatc
cgccagccggtcttcatcgcccatgcccgccacgacgacgtggcgagcttcaacaatgcc
gtgctgctgcaacgccgtctcggcggcacggtggaatgcctggtgctcgacgacagctac
cacctcgtgaccctcgaccggcagcgccatctggtcaccgaccgggtggcggccttcatc
cggggcgtggtggcagcgccaaaccgccatcccgtgctggagccgcgccgcgcggcggcc
gcccgcgccgaacgcaatgcgcccatcgccgctgcggaggtggcccatgtcgcatga

DBGET integrated database retrieval system