KEGG   Xanthobacter autotrophicus: Xaut_1163Help
Entry
Xaut_1163         CDS       T00581                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00220  Arginine biosynthesis
xau00250  Alanine, aspartate and glutamate metabolism
xau00471  D-Glutamine and D-glutamate metabolism
xau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Xaut_1163
   00220 Arginine biosynthesis
    Xaut_1163
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Xaut_1163
Enzymes [BR:xau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Xaut_1163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: ABS66412
UniProt: A7IEG9
Position
1338991..1339986
Genome map
AA seq 331 aa AA seqDB search
MPDVSSIPENERVYGLKGVLEHSFERTRHDASGALADYIPELAKADPDRFGIAMASVSGE
VVGVGDVDLPFTIQSISKALAYCLALEALGRDKVLAHVGVEPSGDAFNAIVFDALSNRPF
NPMVNAGAITVSGLLSEAFGAEAFEVVLDRFSAAAGRRLVMDETVFRSEAQTGHRNRGIA
HLLKCAGALGADVDDAVDLYFRQCSILVTATDLAVMGATLANIGENPLTGSAAFAVEAVR
NTLSVMFTCGMYDFAGNWAFDVGVPAKSGVGGGILGVVNRQLGIGTYSPRLDAKGNSVRG
ISAFRDLAEEMGLHVFDPTNRGSSLLSAYRR
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgccggacgtgtcatcgatcccggagaacgagcgggtgtatgggctcaagggtgtgctg
gagcatagcttcgagcgcacccgccacgacgcctcaggcgcgcttgccgactacattccc
gaactcgccaaggccgatcccgaccgtttcggcatcgcaatggcctcggtctccggcgag
gtggtgggcgtgggcgacgtggatctgcccttcaccatccagtccatttccaaggcgctg
gcctattgcctggcgctggaggcgctgggccgggacaaggtgctcgcccatgtgggcgtc
gagccgtccggcgatgccttcaacgccatcgtcttcgatgcgctgtccaaccgccccttc
aatcccatggtgaatgccggggccatcaccgtgtccggccttctttcggaagcgttcggg
gcggaggcattcgaggtggtgctggatcgcttctccgctgccgccggccgccggctggtg
atggacgagaccgtgttccgctccgaggcgcagaccggccaccgcaaccgcggcatcgcc
catctgctgaaatgcgcgggcgcgctcggcgccgatgtggacgacgcggtcgacctttat
ttccgccagtgctccatcctcgtcaccgccacggatcttgcggtgatgggggcgacgctg
gccaatatcggtgaaaatccgctcaccggcagcgccgcgttcgcggtggaggcggtgcgc
aacaccctgtcggtgatgttcacctgcggcatgtatgattttgccggcaactgggccttc
gacgtgggcgtgccggcgaaaagcggagtgggcggcggcatcctcggcgtggtgaaccgc
caattgggcatcggcacctattcgccgcgcctggacgccaagggcaattcggtgcgcggc
atctcggccttccgcgacctcgccgaagagatggggctgcacgtgttcgaccccaccaac
cgcggctcgtccctgctcagcgcctatcggcgctga

DBGET integrated database retrieval system