KEGG   Xanthobacter autotrophicus: Xaut_1918Help
Entry
Xaut_1918         CDS       T00581                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00630  Glyoxylate and dicarboxylate metabolism
xau00710  Carbon fixation in photosynthetic organisms
xau01100  Metabolic pathways
xau01110  Biosynthesis of secondary metabolites
xau01120  Microbial metabolism in diverse environments
xau01200  Carbon metabolism
Module
xau_M00165  Reductive pentose phosphate cycle (Calvin cycle)
xau_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:xau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Xaut_1918
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Xaut_1918
Enzymes [BR:xau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Xaut_1918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ABS67163
UniProt: A7IGM0
Position
complement(2169093..2170559)
Genome map
AA seq 488 aa AA seqDB search
MGADAAIGQIKDAKKRYAAGVLKYAQMGYWDGDYQPKDTDVLALFRITPQDGVDAVEAAA
AVAGESSTATWTVVWTDRLTAADMYRAKAYKVEPVPGQPGQYFCWVAYDLDLFEEGSIAN
LTASIIGNVFSFKPLKACRLEDMRLPVAYVKTFRGPPTGIVVERERLDKFGRPLLGATTK
PKLGLSGKNYGRVVYEGLKGGLDFVKDDENINSQPFMHWRDRFLYCMEAVNKAQAETGEV
KGHYLNITAGTMEEMYRRAEFAKELGSVVVMVDLIVGWTAIQSISNWCRENDVLLHMHRA
GHGTYTRQKGHGISFRVIAKWLRLAGVDHLHTGTAVGKLEGDPMTVQGYYNVCRETVTKT
DYTRGIFFDQDWAGLRKVMPVASGGIHAGQMHQLIDLFGEDVVLQFGGGTIGHPDGIQAG
AIANRVALETMILARNEGRDIKNEGPEILIEAAKWCRPLRAALDTWGEVTFNYASTDTSD
FVPTASVA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccgacgccgccatcgggcagatcaaggacgccaagaagaggtacgccgccggc
gtactcaaatatgcccagatgggctattgggacggcgactaccagccgaaggacaccgat
gtcctggccctgttccgcatcacgccgcaggacggcgtggacgcggtggaagccgctgcg
gcggtggcgggcgaaagctccaccgccacctggaccgtggtgtggaccgaccgcctcacc
gccgccgacatgtaccgcgccaaggcctacaaggtggagccggtgccgggccagccgggc
cagtatttctgctgggtcgcctacgacctcgacctgttcgaggaaggctccatcgccaac
ctgaccgcgtcgatcatcggcaacgtcttctcgttcaagccgctcaaggcctgccgcctg
gaggacatgcgcctgccggtggcctatgtgaagaccttccgcggcccgcctaccggcatc
gtggtggagcgcgagcgcctcgacaagttcggccggccgctgctcggcgccactaccaag
cccaagctcggcctctccggcaagaactacggccgcgtggtctatgaggggctcaagggc
ggcctcgacttcgtgaaggacgacgagaacatcaactcgcagcccttcatgcactggcgc
gaccgcttcctctactgcatggaggccgtcaacaaggcccaggccgagaccggcgaggtg
aaggggcactacctcaacatcaccgccggcaccatggaagagatgtaccgccgcgccgag
ttcgccaaggagctgggctccgtggtggtgatggtggatctcatcgtgggctggaccgcg
atccagtccatctccaactggtgccgcgagaacgacgtgctgctgcacatgcaccgcgcc
ggccatggcacctacacgcgccagaagggccacggcatctcgttccgcgtcatcgccaag
tggctgcgcctcgccggcgtcgaccatctccacacaggcaccgcggtgggcaagctggaa
ggcgaccccatgaccgtgcagggctactacaacgtctgccgcgagaccgtgaccaagacc
gactacacccgcggcatcttcttcgaccaggactgggccggcctgcgcaaggtgatgccg
gtggcctccggtggcatccatgccggccagatgcaccagctcatcgacctgttcggcgag
gacgtggtgctgcagttcggcggcggcaccatcggccatcccgatggcatccaggccggc
gccatcgccaaccgcgtcgcgctggaaaccatgatcctcgcccgcaacgagggccgggac
atcaagaacgagggtcccgaaatcctcatcgaggccgccaagtggtgccgtccgctgcgc
gccgccctcgatacctggggcgaggtgaccttcaactacgcctccaccgacacttccgac
ttcgttcccaccgcgtccgtggcctga

DBGET integrated database retrieval system