KEGG   Xanthobacter autotrophicus: Xaut_2879
Entry
Xaut_2879         CDS       T00581                                 
Name
(GenBank) Conjugal transfer protein TrbC
  KO
K20528  type IV secretion system protein TrbC
Organism
xau  Xanthobacter autotrophicus
Pathway
xau02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:xau00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Xaut_2879
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xau02044]
    Xaut_2879
Secretion system [BR:xau02044]
 Type IV secretion system
  Trb secretion system protein
   Xaut_2879
SSDB
Motif
Pfam: TrbC
Other DBs
NCBI-ProteinID: ABS68118
UniProt: A7IJC5
Position
3204901..3205233
AA seq 110 aa
MIRHALRARRHIATAASVAVFSMMLAPAAHASGSSMPWEAPLQSILESIEGPVAKIIAVM
IIIITGLTLAFGDTSGGARKLIQIVFGLSIAFAASSFFLSFFSFGGGALV
NT seq 333 nt   +upstreamnt  +downstreamnt
atgatccgccatgccctgcgcgctcgccgtcatatcgcgacggccgcgtccgtcgccgtc
ttcagcatgatgcttgcgccagcagcccatgcttccggctcttcgatgccgtgggaagcg
ccgctgcaatcgatcctcgaatccatcgaggggcctgtggccaagatcatcgctgtgatg
atcatcatcatcacagggctaacgctagccttcggcgatacgtcaggcggcgcgcggaag
ctgatccagatcgtcttcggcctgtcgatcgccttcgccgcgtcgagcttcttcctgtcc
ttcttctccttcggcggcggagcgctcgtctga

DBGET integrated database retrieval system